KEGG   Sinocyclocheilus grahami: 107570825
Entry
107570825         CDS       T04918                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107570825
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107570825
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 107570825
NCBI-ProteinID: XP_016112582
Position
Unknown
AA seq 314 aa
MALVFLPALARMAVCGGTHGNELSGVYVVQEMERQRKENGEGVWPIPVTTVLSNPRAVKE
CRRYIDTDMNRCFNRDTLSSPITDSSPYEVRRAQELNNLLGLKGSTDAADVICDLHNTTS
NMGLTLIRYTSSDWVTLHICKYLQTKITKVPVRVLVLDVPISDAYSLESVSKHGFSLEIG
PQPHGVVRADIYIIMKEAVDLTIDWIHKFNSGTVFEGGDVEAFKFIKSVDYPRDPETWTL
TAAIHPQLQDKDFCLLKRGDPLFLXFSGETVNYEEEETLHPFFINEAAYYEKGIAFHLGK
KMMLTIPTVQVQKD
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcattagtgttcctgccagcactggctcgtatggccgtatgcggcggcacccatggg
aacgagctgtccggtgtgtatgtggtgcaggagatggagcgacagcggaaagaaaacgga
gagggtgtgtggccgattcctgtaacaactgtgctgtcaaacccaagggctgtgaaagag
tgcagaagatacattgacacagatatgaaccgctgcttcaacagagacacgctgagttct
cctattacagacagcagcccgtatgaagtccggcgtgctcaggaactgaacaatctgctg
gggctgaaaggatccaccgatgcagcagacgtgatctgtgaccttcataacaccacgtcc
aacatgggcctcacactcatccgttacacatccagtgactgggtgaccctgcacatctgc
aaatacttacagactaagattaccaaagtgcctgtgagagtgctggtactggatgtcccg
attagtgatgcttattccttggagtctgtgtccaagcatggcttttcattagagatcggg
ccgcagccgcatggtgtcgtcagagcagatatctatattattatgaaagaggccgtcgac
ttgacaatagactggatccacaaattcaactcaggaacggtgtttgaaggcggggatgta
gaagcctttaagtttatcaaaagtgttgattatccaagagatccagagacttggactctc
actgctgccattcatcctcagctgcaggacaaagacttctgtcttctcaagcggggagac
cctttatttttgtaattttctggagaaactgtgaactacgaggaagaagagacacttcat
cctttctttatcaatgaggctgcttactatgaaaagggaatcgcttttcacttgggaaaa
aagatgatgctgacgattccaacggtgcaagtgcagaaagactga

DBGET integrated database retrieval system