KEGG   Sinocyclocheilus grahami: 107571175Help
Entry
107571175         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107571175
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107571175
   04261 Adrenergic signaling in cardiomyocytes
    107571175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107571175
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107571175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin
Motif
Other DBs
NCBI-GeneID: 107571175
NCBI-ProteinID: XP_016112951
Position
Unknown
AA seq 193 aa AA seqDB search
MSACGRKALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILPLNQSADIRMSIHSGLWR
VCFLAGEERGRCFTIEYVMPMSVQLTSESTVSVLSNISFRKCFLLSVQSAGVMSVYLFMK
RYTAEEIYQPHPSFYRPRLSNCSDYSGQFLQPNAWTRGRSPSDISSDTSLQMNASYPALL
KCPDYAQVSSSPC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtgcgggaggaaggccctgaccctgctcagcagtgtgtttgcggtatgcagt
ctggggctgctgggtatcgccgtcagcactgactactggctctacctggaggagggcgtc
atcctgcctctcaaccagagtgctgacatacgcatgtccatccactccggcctctggaga
gtctgttttctggcaggtgaggagaggggtcgctgcttcacgatcgagtatgtgatgccc
atgagcgttcagctgaccagtgagtctactgtcagtgttctgagtaatatttccttcagg
aaatgttttcttctctctgttcagagcgcaggtgtgatgtctgtctacctgttcatgaag
cgttacacagcggaggaaatctaccagccccaccccagcttctaccggccgcgcctgagc
aactgctccgattactcgggtcagttccttcagcccaacgcctggacgcggggacgcagc
ccgtcagacatctccagcgacacctcgctccagatgaacgccagctaccctgccctgctc
aagtgccctgactacgcccaggtgtcttcctctccctgctga

DBGET integrated database retrieval system