KEGG   Sinocyclocheilus grahami: 107573290
Entry
107573290         CDS       T04918                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107573290
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107573290
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 107573290
NCBI-ProteinID: XP_016115201
Position
Unknown
AA seq 552 aa
MIPPGDCLYAGRKRRKPVQKQKPAAVTEKSNPSKRHRDRLNTELERLASLLPFSPEIISK
LDKLSVLRLSVSYLRVKSFFSAAQENPREKHVNGKECDTTASGVPESQLLLESLAGFALV
VSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHWAMNPSAQSGSGE
DLVVSSLFQSETGDVPPEFSCFLNRCFILRFRCLLDSTSGFLTMQFQGRLKFLQGQRKKT
ASGALLRPQLALFCVVVPLLLPSITEMKMKSGVMKGKHRNLGVLTSLDHNDRDDPLRPLA
LLRPHMSEDNVKYRNEGPYDPDEPLNFCRSSGQNLDCGTWPVRSSGARLCKHTHYGKPYR
SAPGYYSNRAEAYGSAAHDDYSTDSIKSENFCYEDPGEGYDTHVMIEPLIKLEQDSDAEN
GCGRPWMDLERFPNGTQMKAEGGYGEQYSSCQRLKGTTYSSHYTSNAYGGARPLKCVLNR
EAVNSQCVDAYAADYRGYVQHDYKTGYEVRGHGLLHCIKQEPVDAPLWHDIHSTGQRNNT
SCAKINPCVFMQ
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgattcctcctggagactgtctgtacgctgggaggaagaggaggaaacccgtccagaag
caaaaaccagcagcagtgacggagaaatcgaacccgtcgaagcggcaccgtgaccgtctg
aacactgagctggagcgactggccagcctgctgcccttctcccccgagatcatctccaaa
ctggacaaactgtctgtcctgcgcctgagcgtcagctacctgcgggtcaagagcttcttc
agcgctgctcaggaaaaccctcgtgagaaacacgtgaacgggaaagagtgcgacacgaca
gccagcggtgtccctgagagccagctgctgctagagtctttagcaggttttgcgctggtc
gtcagcagtgatgggatggtcttctacgcctcctccaccatagtcgactatctgggcttc
caccagacggatgtgatgcatcagaacgtgttcgactacattcacgtggacgaccggcag
gagttcagacggcagctgcactgggccatgaacccttcggctcaaagcggctcgggtgaa
gatcttgtggtcagcagtttgtttcagtctgagacgggcgacgttcctccagagttctcc
tgcttcctaaaccgctgctttatcctgcgcttccgctgcttactggacagcacctccgga
ttcctgacgatgcagtttcagggaagactgaagttccttcagggtcagaggaagaagacg
gcgtccggagcgctcctgcgtcctcagctggcgctgttctgtgtcgttgtgcctctgctc
ctgccctccatcaccgagatgaagatgaagagcggcgtgatgaagggcaaacacaggaac
ctcggcgttctcacctcgttagatcacaatgacagagacgatcctctcagacctctcgcg
cttctgaggccacatatgagcgaagacaacgtcaagtacaggaacgaaggtccctacgat
ccagacgagcctctgaacttctgcaggtcgagcggtcagaacctggactgcggcacgtgg
cccgtgagaagctccggcgctcggctctgcaaacacacgcactacggtaaaccgtatcga
tcggcccctggatattacagtaacagagctgaggcgtacgggagcgccgcgcacgacgac
tacagcacagacagcatcaagagcgagaacttctgctacgaagatcccggcgagggatac
gacacacacgtgatgatcgagccgctcataaagctggagcaagactcagacgcggagaac
ggctgcggacgtccctggatggatctcgagcgtttcccgaacggcacgcagatgaaagcg
gagggtggatacggcgagcagtactcctcctgccagaggctgaagggaacgacgtacagc
agtcattatacctctaacgcttacggcggggcacgaccgctcaagtgcgtcctgaacaga
gaagcagtgaactctcagtgtgtggacgcctacgctgctgactacagagggtacgtacag
cacgactacaaaacgggttacgaggtcagaggtcacgggctgcttcactgcatcaaacag
gagcccgtcgacgctccgctgtggcacgacatccacagcaccggccagaggaacaacacg
agctgtgccaagatcaacccgtgcgtcttcatgcagtag

DBGET integrated database retrieval system