KEGG   Sinocyclocheilus grahami: 107576481
Entry
107576481         CDS       T04918                                 

Definition
(RefSeq) apelin-like
  KO
K05225  apelin
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
sgh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107576481
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107576481
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107576481
NCBI-ProteinID: XP_016118135
Position
Unknown
AA seq 97 aa
MKVVNLEEIMSVRRRPTISTIRSNAIRSYFMYHNSHTLFPSAGPMASTEHSKELEEVGSM
RTPLRQNPARAGRSQRPSGWRRRRPRPRLSHKGPMPF
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaaggtggtaaacctggaagaaattatgtcggtgagaaggaggcccactatcagcacc
atcagatctaatgcaataaggagttattttatgtatcataattcacatactctctttccg
tccgcaggtccaatggcctccaccgagcatagcaaagagctggaggaggtgggcagcatg
aggactcctttgcggcagaatcctgctcgagccggccggagccaaagaccttctggctgg
aggaggagacgccctcgaccccgcctctcccataaggggcccatgccattttag

DBGET integrated database retrieval system