KEGG   Sinocyclocheilus grahami: 107576559Help
Entry
107576559         CDS       T04918                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00071  Fatty acid degradation
sgh00350  Tyrosine metabolism
sgh00830  Retinol metabolism
sgh00980  Metabolism of xenobiotics by cytochrome P450
sgh00982  Drug metabolism - cytochrome P450
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107576559
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107576559
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107576559
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107576559
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107576559
   00982 Drug metabolism - cytochrome P450
    107576559
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     107576559
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     107576559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-GeneID: 107576559
NCBI-ProteinID: XP_016118204
Position
Unknown
AA seq 117 aa AA seqDB search
MDTTGKVLKCKAAVAWEAGKPLSVEEVEVAPPKAHEVRVKIHATGVCHTDAYTLSGSDPE
GLFPVILGHEGAGTVESVGEGVTKFKPGDTVIPLYVPQCGECKFCKNPKTNLCQKIR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaccgggaaagtgctcaagtgcaaggcagcagtggcctgggaggctggtaag
cctctttccgttgaagaggtggaagtagctccacctaaagcccatgaagttcgagtgaag
attcatgctacaggtgtgtgtcacactgacgcctacactctgagtgggagtgaccctgag
ggcttgtttcctgtcatcctgggtcatgagggggcaggcactgttgagagtgttggcgaa
ggggtcaccaaattcaaaccaggcgatactgttattccgctgtatgtaccccaatgtgga
gagtgcaagttctgtaaaaatcctaaaaccaacctgtgtcagaaaatcaggtaa

DBGET integrated database retrieval system