KEGG   Sinocyclocheilus grahami: 107577558Help
Entry
107577558         CDS       T04918                                 

Definition
(RefSeq) glutathione peroxidase 1-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00480  Glutathione metabolism
sgh00590  Arachidonic acid metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107577558
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107577558
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107577558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA NdhM
Motif
Other DBs
NCBI-GeneID: 107577558
NCBI-ProteinID: XP_016119134
Position
Unknown
AA seq 191 aa AA seqDB search
MAGAAKKFYDLSAKLLSGDLLNFSSLKGKVVLIENVASLUGTTVRDYTQMNELHSRYADQ
GLVILGAPCNQFGHQENCKNDEILLSLKYVRPGNGFEPKFQLLEKLEVNGENAHPLFVFL
KEKLPQPSDDSVSLMGDPKFIIWSPVNRNDVSWNFEKFLIGPEGEPFKRYSRRFLTIDIE
ADIKELLKRMK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggccgcgaagaagttttatgatctgtccgccaaacttttgtcaggggacctc
ctgaatttttcctccctcaaaggtaaagtggtgcttattgaaaatgtggcgtcgctttga
ggcacaacagtcagggattacacccagatgaacgagctccacagccgctacgctgatcag
gggctcgtgatcctgggcgctccctgcaaccagttcggacatcaggagaactgcaagaat
gatgaaattctgctgtctctgaagtatgtccgtcctggaaatggcttcgagccaaaattc
caacttctggagaagctggaagtgaacggtgagaacgcccaccctctgtttgtgttcctc
aaggagaagctgcctcagcccagtgacgactctgtgtccttgatgggtgatcccaaattc
atcatctggagtccggtgaacaggaatgacgtctcctggaactttgagaagttcctcatc
ggcccggaaggggaaccgttcaagagatacagcagaaggttcctcaccatcgacattgaa
gcagatatcaaagagcttctgaagaggatgaaataa

DBGET integrated database retrieval system