KEGG   Sinocyclocheilus grahami: 107577691Help
Entry
107577691         CDS       T04918                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00340  Histidine metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107577691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107577691
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     107577691
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107577691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 107577691
NCBI-ProteinID: XP_016119224
Position
Unknown
AA seq 275 aa AA seqDB search
MAAPFRSLVEDYPRYLKSFELFLKRSSEHQCMQDFIRNTLPDILPSVLAGKSTFNVMGVG
SGAGEIDLEMLAQLHLKHPHAKVNNEVVEPSNDMLHKYKVRVSTTPDLDYINFTWKKMTA
SEFEKHWQEKNPGKKMDFIHMIQMLYYVKDPEATVSFFRSLLHKDGKLLIILVSGESGWG
KLWTTFREQLCNTEISQCVTTGDIKTFLDTESIPYQNYELLSQMDIXXXXIEFSKNAPED
LKKGVLDLLRHPDCSKEVDGRIIFNNNLGVLVVEP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccattcagatcacttgtggaagattatccaagatacctcaaatcttttgag
ctttttctgaagcgctcatcagagcaccagtgcatgcaggacttcattcgtaatacgcta
ccagacatactgccgtccgtgttggctggtaagtctacnttcaatgtaatgggagtaggg
agtggagcaggtgagattgatctagagatgctagctcagctacacctgaaacatccacat
gccaaagtcaacaatgaagtggtggaaccaagcaatgacatgctgcacaaatataaagtt
cgagtgtcaacaactccagatcttgattatataaactttacatggaaaaagatgacggca
tctgaatttgaaaaacattggcaagagaaaaaccctgggaaaaagatggacttcattcac
atgatacagatgctgtactatgtcaaagatccagaggccactgtctcattttttcggagt
cttctacacaaagatgggaaactcttaatcattctggtgtcaggtgagagtggatgggga
aaattatggacaacctttagagaacaactctgtaatactgagatcagccagtgtgttact
acaggagatataaagaccttcctagatactgagagcatcccctaccagaactatgagctt
ctgtcccagatggacatcannnnnnnnnncatagagttcagtaagaatgctcctgaagac
ctgaagaaaggagtgctggacttactgagacatcctgactgcagcaaagaggtggatgga
aggatcatattcaacaacaacttgggagtattagtggttgagccatag

DBGET integrated database retrieval system