KEGG   Sinocyclocheilus grahami: 107577707Help
Entry
107577707         CDS       T04918                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107577707
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107577707
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sgh04812]
    107577707
   04147 Exosome [BR:sgh04147]
    107577707
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107577707
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107577707
Membrane trafficking [BR:sgh04131]
 Others
  Actin-binding proteins
   Others
    107577707
Cytoskeleton proteins [BR:sgh04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107577707
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107577707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Pur_ac_phosph_N ig Ig_2 Y_Y_Y V-set
Motif
Other DBs
NCBI-GeneID: 107577707
NCBI-ProteinID: XP_016119240
Position
Unknown
AA seq 1336 aa AA seqDB search
MLVTWTEPKDNGSPIEGYWVEKREVNSTHWARVNRTMVPDLEINVEGLLEGLTYIFRVCA
ENVAGPGKFSPPSEPKTAQASIRPPGPPIPRIVDTSDYSIDVEWDPPADNGGADIFGYHV
DKVVAGTKDWSRATERPWKNHTFTVFGVREGAKYIVRVVAVNCAGEGQPGFTDAVIVRNP
AEVPVIELDISVKNGVVVRAGEMLRIPAHVTGRPFPSLKWTKDDGPLEKDRMEVEEAGKD
STIVIKTTKRSDHGKYQIQAANPSGIKSAWTRVEVMDVPGPVLDLKPVVVTRKLMMLNWS
DPDDDGGSDLTGFIVERREPKMHTWRQPIETASSKCEIVGIIEGQEYIFRVVAKNKYGCG
PPVDLGPIRAVDPQGPPTSPEKFHYTERTKSSVTIEWRPPRNDGGSPILGYIIEKKRQDQ
PAFQRVNPELMTAQILTVEDLDELHMYEFRAKAVNAFGESEPSITMTVVIQDDEVAPSLH
MLKHFKGDLIQVRKNQPIEMPAEVTGLPMPKIEWLKDDVVIAKPTEKLLIETKEIDRLTS
HTKLSIPGVTRLDKGTYTVTASNRLGSLGHSIMVEVLDRPTPPRNIAVSDIKAESCKLSW
DAPLDLGGSELTNYIVEMKDLNGEDPEKAEWVQVTNSIIEKHYAVWNLKTGGNYKFRVKA
ENKYGISEACETEEVQIKDPFALPGPPEKVTIAERSKTHMILTWEPPRDSGGSMITGYWL
EKREKGTSYWSRVNKILVSKRGMKGWEYQVTRLIEGTEYEFRAMACNSAGIGPPSAISES
AVADDPLTPPSMPAAPEIADKTKHNVTLAWTPPAKDGGRPIKAAPKIFVDISADELLCIR
AGTPFKIPATITGRPVPKVSWEFDGKAKTEKKDRLHVLPVDSQVESTDTTSVVTIPVSLR
SHSGRYTITAKNKSGQKHVNVRVNVLDVPGAPKELKVTDVTRTTMRLIWKLPDNDGGERI
KSYFIEKKAVNGKAWTVANATCASMAFVVSNLLEGQDYLFRVRAENRLGFGPFTETTEPV
RARDPIYPPDPPTKVKINLVTKNTVTLTWVPPKNDGGAPVKHYIIERLSWDTSGPQKETW
KQCNKRDVEETTFIVEDLKEGGEYEFRVKAVNEAGASRPSVTAGPVVIKDQTCGPSIELR
EALEGAEGYDVSIVARIQGCPFPSLVWHKAPQEKPDDKALVQYDKHVNKLVSDEKCTLLI
QQSKRDDSAVYTLTATNNLGTATKSIKLSILAVPGQCEKPTVTDVSLESMTVNWDEPEYD
GGSPVTGYWLERKETTGKRWTRVNREPIRIRTLGVSHIVTGLLEGAIYQFRVLAINAAGS
GPPSLPSDPVACRDPI
NT seq 4009 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttacctggacagaacccaaagacaatggcagccccattgagggatactgggta
gagaaacgagaagttaacagcacacactgggcaagagtcaatcgcaccatggttcctgat
ttggaaataaatgtagagggccttttggagggtctgacatatattttcagagtctgtgcg
gaaaatgtagcaggacctggaaagttcagccccccgtcagagccaaaaacagcacaggca
tcaatcaggcccccaggtccaccaattccaagaattgtcgacacctcagactattcaatt
gatgttgaatgggatcctcctgcagacaatggtggcgcagacatctttggttatcatgtt
gacaaagttgttgctggtaccaaagactggtcacgagccacagagagaccatggaagaac
cacacatttacagtgtttggtgttagagaaggagctaaatatattgtccgtgtagtggca
gtcaattgtgctggtgaaggacaaccaggttttactgatgcagttattgtgagaaaccct
gcagaggttccagtcatcgagcttgatatctcagtgaaaaatggtgttgttgttagagct
ggagagatgctgagaataccagcacatgtgactggtagaccttttccatctttgaaatgg
acaaaggatgatggtccattagaaaaagatcgtatggaggtagaggaagctggaaaggac
agcactattgttatcaaaaccacaaagagaagtgatcacggcaaataccaaatccaagca
gcaaatccaagtggtatcaagtctgcatggaccagggttgaagttatggatgttcctgga
ccagttcttgacctgaaacctgttgtggttaccagaaagctaatgatgttgaattggtca
gatcctgatgatgatggtggtagtgatctgacagggtttattgttgaaaggagggaacca
aagatgcacacatggagacaacctattgagaccgcttcatccaaatgtgagattgtaggt
attattgagggacaggaatacattttccgtgttgtggctaagaataagtatggatgtgga
cctccagtcgatcttggacctatccgtgctgtggatcctcaaggtccaccaacttctcct
gaaaagttccactataccgagcggaccaaatcctctgttactattgaatggaggccacct
cgtaatgatggtggtagtccaatccttggctacatcattgagaaaaagcgacaagatcaa
ccagccttccagcgtgtcaacccagagttgatgactgctcaaattttgacagttgaagac
cttgatgagttgcatatgtatgagttccgtgcaaaggctgtcaatgcatttggtgaaagt
gagccttcaattaccatgactgttgtcattcaagatgatgaagtggctccaagtctgcat
atgttaaagcacttcaagggtgatttgattcaagtaaggaaaaaccaacctattgagatg
cccgctgaagtcacaggcctgccaatgccaaagatcgaatggctgaaggatgatgttgtt
attgccaagccaactgagaaactcctgatagaaaccaaagagattgataggctgacatca
catacaaaactctccatccctggtgttactagattggacaagggcacatacacagttact
gcctcaaatcgtttgggatctcttggtcattccatcatggtggaagtgttggatcgccca
acaccaccaagaaacattgctgtttcagatatcaaagctgagtcttgcaaactatcctgg
gatgccccattggatcttggtggcagtgaacttaccaactacattgttgagatgaaagac
cttaatggtgaagatcctgaaaaggccgagtgggtgcaggttactaactccattatcgag
aagcattatgcggtatggaacctgaaaactggtggcaactataaattcagagtcaaagct
gagaataaatatggaataagtgaggcctgtgaaacagaggaggttcagattaaggatcct
tttgctctgcctggcccacctgagaaggtcactattgctgagcgctctaagacccatatg
atactgacatgggaaccacctagggacagtggtggttctatgattactggctactggctt
gagaagcgtgaaaagggcacttcgtattggtctcgcgtgaataagatcctggtgtcaaaa
cgtggcatgaaaggctgggaataccaggttacccgtctcatcgaaggaacggagtatgaa
ttccgtgcaatggcttgtaattctgctggtattggaccacctagtgccatctctgagtct
gccgttgctgacgatcccttgactccacctagcatgccagcagctcctgagattgctgac
aaaaccaagcataatgtcacccttgcgtggaccccaccagctaaagacggtggccgcccc
atcaaagctgcaccaaagatcttcgtggatatcagtgctgatgaactgctctgtatccgt
gctggaactccatttaagattccagctaccatcacaggacgtcctgttcctaaagtttca
tgggagtttgatggcaaagcaaagacagaaaagaaggatcgtctccatgttttaccagtg
gattcacaggttgaatctacagacactacctcagttgttacaattcctgtgagtttgaga
agccattctggcaggtacacaatcacagcaaagaacaaatcaggacagaagcatgtcaat
gtcagagtaaatgtgcttgatgttcctggagcacccaaagagctcaaagttactgatgtc
accagaaccacaatgagacttatttggaaactgccagataatgatggtggtgagagaatc
aagagttattttattgaaaagaaggctgtgaatggaaaggcttggacagttgccaacgct
acttgtgccagcatggcctttgttgtgtccaacctcctcgagggacaggactacttgttc
cgtgttcgtgctgagaatcgccttggctttggaccgtttaccgagaccacagagcctgtt
agggcaagggatcctatctatcctcctgatcctcctaccaaggtgaaaattaaccttgtt
accaagaacactgtgaccctgacatgggtgcctcccaagaatgatggtggagcaccagta
aaacattatatcattgagaggctgagctgggataccagtggtccacagaaagagacgtgg
aaacagtgtaacaagagagatgttgaagagactaccttcattgttgaagaccttaaggaa
ggtggcgagtatgaattccgtgttaaagctgtgaatgaagctggcgcaagcagaccctct
gttactgccggaccagttgtcattaaggaccagacatgtggtccaagtattgaactcaga
gaggctttagaaggtgcagaaggatatgatgtcagcattgttgccaggattcaaggctgc
ccattcccatctcttgtctggcacaaggctccacaggaaaagcctgatgacaaagcactt
gtacagtatgacaaacatgtcaataaacttgtttctgatgagaaatgcaccctgttaatt
cagcagtcaaagagagatgacagcgccgtatacactctcacagccaccaacaatttggga
acagccaccaagagcatcaagcttagcattttggctgtgcctggccaatgtgagaagcca
actgtcacagatgtttcacttgaatctatgaccgttaactgggatgaaccagaatatgat
ggtggctctcctgtaactggctactggctagagcgtaaggaaactacaggcaagcgctgg
acaagagtgaatcgtgaacctatcagaatcaggactctaggagtttcccatattgtgaca
ggcctcttggagggtgctatctatcagttccgcgttcttgcaattaatgcagctggaagt
ggcccacctagtttaccttctgatcctgttgcatgtagagatccaatag

DBGET integrated database retrieval system