KEGG   Sinocyclocheilus grahami: 107578564Help
Entry
107578564         CDS       T04918                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00020  Citrate cycle (TCA cycle)
sgh00640  Propanoate metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
Module
sgh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107578564
   00640 Propanoate metabolism
    107578564
Enzymes [BR:sgh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107578564
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107578564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 107578564
NCBI-ProteinID: XP_016119996
Position
Unknown
AA seq 167 aa AA seqDB search
LEGTVWTVDHHQQIIFLDWRGSFVFQIQYVFIGTFHSQQSLDYGSQLVGGVSPGKGGKTH
LGLPVFNSVKEAKDGTGANATVIYVPPPFAAAAIIEAIDAEIPLAVCITEGIPQQDMVQV
KHKLLRQSKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGKSSTG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttagaaggaacagtgtggactgtggatcaccatcaacaaattatctttttagactggcga
ggaagttttgtgtttcagatacagtatgttttcataggcacctttcacagtcagcagtct
ctggactatggctcgcagttagtaggaggagtgtctccaggcaaggggggcaaaacacac
ctgggtctgccagtcttcaactctgtgaaagaggctaaggatggcacaggggccaatgcc
acagtgatctatgtgccgcctcctttcgcggcagccgccatcatcgaagcaattgatgca
gagataccactggccgtctgcatcacagagggaatccctcagcaggacatggtgcaggtc
aaacacaagctgctccgccagagcaagacccgcctcgtcggccccaactgtcccggtgtc
atcaatcctggcgagtgcaaaattgggatcatgcctggacacatccacaagaaaggaaga
attggtaagagctccactggatga

DBGET integrated database retrieval system