KEGG   Sinocyclocheilus grahami: 107580037Help
Entry
107580037         CDS       T04918                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107580037
   00562 Inositol phosphate metabolism
    107580037
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107580037
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107580037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107580037
NCBI-ProteinID: XP_016121276
Position
Unknown
AA seq 182 aa AA seqDB search
MVSVIRHGTRYPTTKNVKKIARLFELVVSHASGSASWLNDIKTWKMWYTEDMDGRLVEKG
RDDHRHLAMRLAQSFPTLISEDHLRANRIEFITSSKHRCVDSVKAFQEGLHRLWDVQDMD
YKHYVDDSLMRFFDHCERFVESVEKNKTALKEVERFKSSAEMDAVRRKISSRLQIPYSQF
TP
NT seq 547 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcggttatccgtcacgggacgcgctacccaaccaccaaaaatgtgaagaagatc
gcgcgattgtttgagctggtcgtgtctcacgcgtcgggttcagcctcgtggctaaatgac
atcaagacatggaagatgtggtacactgaagacatggacggcagactggtggagaaaggg
cgcgatgaccacaggcatttggctatgagactggcacagtcttttcccactttgatttct
gaggatcatctccgtgccaaccgcattgagttcatcaccagctccaagcatcgctgtgtt
gatagtgtcaaagcttttcaagagggtcttcaccgactctgggatgttcaggatatggat
tacaaacactatgtggatgattcactcatgagattctttgaccattgtgagagatttgtt
gaaagtgttgagaaaaacaaaaccgctttgaaagaggtagaacgctttaaatcttcagca
gaaatggatgcagtacggaggaaaatatccagtcgccttcagattccatacagtcaattc
accccag

DBGET integrated database retrieval system