KEGG   Sinocyclocheilus grahami: 107582226
Entry
107582226         CDS       T04918                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107582226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107582226
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107582226
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED Zn-ribbon_8 zf-C2H2_11 zf-met PyrI_C
Other DBs
NCBI-GeneID: 107582226
NCBI-ProteinID: XP_016123463
Position
Unknown
AA seq 1133 aa
MPQTQRSRTSFIRGCGEQTGLDGRVCDSRSWLRHVQISPSTHQHNLTACQIHEQIFYRVV
REVQPGEELLLFMKAEEFSCETMAPDIHEERQYRCEDCDLNFESGSELLDHQKHACGTPP
SSGFKLSKQGLPSTADDPDLDLLHLHTHPLNLPRFPQECKECEQVFPDAQSLDTHSLSHS
DEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHMGAR
AHACPDCGKTFATSSGLKQHKHIHASVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIK
CKDCGQMFSTTSSLNKHRRFCEGKNHFAAAAGGFFAQGVALPGTPGLDKSALAGMSHGSP
SLADYFGTNRHHGGLTFPAAPPAFPFSFPGLFPSGLYHRPPIIPSTSPISGPLSGELRKS
PLLSSPISGSHDLLKSLHKDSFNGESESMERQREGSVSKPRHGRKMSDQSESSDLDDVST
PSGSELESTSGSELDSEAESDRERVRVRENGKGPKRKSSGFNDAQSPTLVSSSSSSNTNN
GKDFPVPGLLPSSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGMQDKKVGALPYPSM
FPLSFFPAFSPSVYPFPEREQLRPPGHKGEPESPLIEGKKLLGRNAESPFDLTTKRKVER
LAATCTPLKPEASHVQSANQDQPLDLSLGGRSRRKSVRGEELKKNPVFGEERVEPEPPKA
DPSLQHARPTPFFMDPIYRVEKRKMNNPFEVLKDKYMRPAPGFLFHPQMSAIENMAEKLE
SFGSLKPDAGDIMHSVPSMFDFRAPPTTLPETLLRKGKERYTCRYCGKIFPRSANLTRHL
RTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH
ENGNLSGTAMSSPRSELDSGSAILEDKEDSYFNEIRNFISNTAQNATSPSHSEEGLNGSH
FDGDKALPGQGSRDLDEEEGEGLGAEEEEVEHSDSARKPSGDGVPSSLDHDINDDIDFEG
PDDLEMNSKSSPRRFNEDEDDEDHSSFSTLDHIRHFSVEDGDLSDSDVTSFGPAHLQEGI
KQPLYRKSKSQAYAMMLSLADKDALHSSTHNAPMWHSLARAAEPSAIQSLSHV
NT seq 3402 nt   +upstreamnt  +downstreamnt
atgccgcaaacacagcggtcgcgcacgagcttcattcggggctgtggcgagcagaccggt
ttggatgggcgcgtgtgtgatagcaggagctggctaaggcacgtccagatctctccatcc
acccaccaacacaacctcacagcctgccagatacatgagcagatcttttaccgtgtggtc
cgagaggtccagccgggtgaggaactcttactgttcatgaaggctgaggagttttcatgt
gagaccatggctccagacatacacgaggagcgtcaataccgttgtgaggactgtgacctg
aactttgagtctggttcagagctgctggaccatcagaagcatgcatgcggtaccccgcct
tcctccggcttcaagctgtctaagcagggtctgcccagcaccgcagacgatcctgatctt
gatctgctgcacttacacactcaccccctgaacttaccccgcttcccacaggagtgtaag
gagtgtgagcaggtctttcctgatgcccagagtctggacactcactctctgtctcactcc
gatgagagggagtataagtgtgatcagtgtccaaaggcattcaactggaaatcaaacctg
attcgccaccagatgtcacatgacagcggcaagcattatgaatgtgaaaactgctcaaag
gtgttcacagacccaagtaacttacagaggcacatccgctctcagcacatgggggcgcga
gctcacgcctgccccgactgtggcaagacattcgccacttcctcgggccttaaacaacac
aaacacatccacgcttccgtcaagcccttcatatgtgaggtctgccacaaatcttacaca
caattctccaatctatgccgccacaagcgcatgcacgcggactgtcgcactcagattaag
tgcaaagactgcggccagatgtttagcaccacgtcgtccctaaacaagcatcggcgcttc
tgtgagggtaaaaatcattttgctgctgctgccggaggattttttgcccagggcgtggcc
ctccctggcacccctggcctagacaagtccgcactggctggaatgagccatgggagtcct
agtttagcagactattttgggacgaaccggcaccatggtggactgacattcccagcagca
cctccagcattcccattcagttttccagggcttttcccatcaggactttaccaccggccc
cctataatcccatccacgtcacccattagcggccctctgagtggtgaactacgaaagagt
ccgctgctgtcctcacccatctctgggtcgcatgacctcttgaagagtttacacaaggat
tcgttcaacggggagagtgagagcatggagcgtcagagggaaggatctgtctccaaaccg
aggcacggcaggaagatgagtgaccagtcggagagtagcgatctggacgacgtcagcact
ccgagcgggagtgagctggaaagcacttcaggttcagagttggacagcgaagcagaaagc
gaccgggaacgggtgcgagtgcgggagaacgggaagggcccgaaaaggaagtcaagtggg
ttcaatgatgcccaaagcccaactcttgtcagctccagtagtagtagcaacaccaataat
ggaaaagacttccctgtgccggggctccttccatcatctttggacgagcaaacggctgtt
tccggtgccgttaatgactcgataaaggcaattgcctccattgctgagaaatactttggt
tctactggacttgcaggcatgcaagacaaaaaagttggggcattgccatacccttccatg
ttccctctgtctttctttcctgccttctctccatcagtctatccgttccctgaaagggag
caacttagacctccaggccacaaaggggaaccagaaagccctctgattgagggtaaaaaa
cttctgggcagaaacgctgaatcaccttttgacctcaccaccaagcggaaggtagaacgt
cttgcagctacctgcacccctttgaaaccggaagcctcacacgtacaatcagccaatcag
gatcaaccgctggacctaagtcttggtggacgaagtcgaagaaagagtgtaagaggggag
gagttaaaaaagaaccctgtctttggtgaggagagggtagaaccggagccacctaaggcc
gacccttcactccaacatgcaagacctacacctttcttcatggatcccatttacagggtt
gagaaaagaaagatgaacaatcctttcgaagtcctcaaggacaagtatatgcggccggct
cctggatttctcttccacccacagatgtcggcgatcgaaaatatggccgaaaagctggaa
tcctttggctctttgaagccagacgccggtgacatcatgcattccgttccctccatgttc
gacttccgggctccgcccaccacccttcctgagacactgttacgcaaaggcaaagagcgc
tacacctgcagatactgtggcaagatattcccacgctcggccaaccttacaagacatcta
cggacacacacgggagagcagccttacagatgtaagtactgcgatcgttcgttcagtatt
tcgtcgaatcttcagcgtcacatccgtaacatccataacaaagagaaacccttcaaatgt
catctttgtgaccgctgcttcgggcagcaaaccaacctggaccggcacctcaaaaagcat
gagaacggtaatttatcaggcacggcaatgtcgtcgccccgttcagagctggacagtggt
agtgccatcttagaggacaaggaggactcgtattttaacgaaatacggaacttcatcagt
aacacagcacagaacgccacatctccgtcacactctgaggaagggctgaacggcagtcat
tttgatggcgacaaagccctgcctggtcaggggtcacgtgacctggatgaagaagaaggg
gaggggcttggagcagaggaagaggaggtggagcatagcgacagtgccaggaaacctagc
ggggacggcgtgcctagcagtctggatcatgacataaatgatgacatcgatttcgaggga
ccagatgatctggagatgaatagcaaatcctcgccacgaaggtttaatgaggatgaggat
gatgaagatcacagcagtttctccacgctggatcacatccgtcactttagtgtggaggat
ggagacctcagcgacagtgatgtcaccagctttggtcccgcccaccttcaagaaggcatc
aagcagcctctatacaggaaatctaagtcacaggcatatgctatgatgctgtctctagct
gataaggatgcactccattcgtctacccataatgccccgatgtggcacagcttggcccgc
gctgcagaacccagcgccattcagtctctcagtcacgtatga

DBGET integrated database retrieval system