KEGG   Sinocyclocheilus grahami: 107583147Help
Entry
107583147         CDS       T04918                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107583147
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sgh04812]
    107583147
   04147 Exosome [BR:sgh04147]
    107583147
Membrane trafficking [BR:sgh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107583147
Cytoskeleton proteins [BR:sgh04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107583147
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107583147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin Fez1
Motif
Other DBs
NCBI-GeneID: 107583147
NCBI-ProteinID: XP_016124747
Position
Unknown
AA seq 388 aa AA seqDB search
MNARDINLSAWPKAMWQGCCPRLSHISCGDNLWSCFQVEQSKVLIKEGGVQLTLTIVDTP
GFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPL
DIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDSK
LIRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEEGIIVENGEHCDFTVLRNMLIR
THMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMK
KMEIEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKEIEEKRRQFEEEKANW
EAQQRILEQQKLDASKTMEKNKKKGKIF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccgtgatataaatttgtcagcctggccaaaggccatgtggcaaggctgctgt
cccaggctaagtcacatatcctgtggtgacaacttgtggtcctgctttcaggtggaacag
tccaaagtgctgataaaggaggggggcgtccagctcactttgaccatcgtagacacacca
ggctttggagatgcagtggacaacagcaactgctggcagcccgtcatcaactacatcgac
agtaagtttgaagacttcctgaatgctgaatcccgcgtaaacaggaggcagatgcctgac
aacagggtgcactgctgcttgtacttcatcgccccctctggtcacggactgaagcctctt
gatattgagttcatgaagcgtcttcatgacaaagtcaatgtcatccccctcatcgccaag
gctgatactctcacgccagaggagtgccaactgttcaaaaaacagattatgaaggagatc
caggagcacaaaatcaagatctatgagtttcctgacacagaggatgatgaggacagcaaa
ctgatccgaaagataaaggagaagatgcctctggcagtggttggtagcaatgtggtgatc
gaagtaaatggcaggaaggttagagggcgtcagtacccctggggtgtggcagaagagggc
attattgtggagaacggtgagcactgtgacttcacagtcctgaggaatatgctcatcagg
actcacatgcaggacctgaaggacgtgaccaataatgttcactatgaaaactaccggagt
aagaaattagcagccgtcacctgcaacggggtcgacgccaccaagaacaagggccagctc
acaaagagtcccctggcccagatggaggaggagaggagggagcatgtgatgaagatgaag
aagatggaaatagagatggagcaggtctttgagatgaaggtcaaagaaaagaagcaaaag
ctgaaggactctgaggcagagttggagcggcgtcacgaacagatgaagaagaatctagaa
gctcagtataaagagattgaggagaagaggcgccagtttgaggaggaaaaagccaactgg
gaggcccagcaacgcatcctggagcagcagaaacttgatgcatcaaagacaatggaaaag
aacaagaaaaaaggaaaaatcttttaa

DBGET integrated database retrieval system