KEGG   Sinocyclocheilus grahami: 107584047Help
Entry
107584047         CDS       T04918                                 

Gene name
camk1d
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107584047 (camk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107584047 (camk1d)
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107584047 (camk1d)
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107584047 (camk1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Tyrosinase
Motif
Other DBs
NCBI-GeneID: 107584047
NCBI-ProteinID: XP_016125936
Position
Unknown
AA seq 369 aa AA seqDB search
MARENGEAGGDCSWKKQVDDIKEMFEFKEVLGTGAFSEVVLAEERSTGKMFAVKCIPKKA
LKGKESSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLMARWATTQITANWKMKNV
DLDREEERGWQSAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKA
DYEFDAPYWDDISDSAKDFISCLMEKDPTKRYTCEQALRHPWIAGDTALCKNIHESVSRQ
MRKNFAKSKWRQAFNATAVVRHMRRLQLGSSMGSSMDQSNNANQNRILNANQTPNTTAAL
TQNHKPAPNANAVLVNDMATSIPRKDCTAPPHTSCSLASTASSSTSGAEPCRPLPPSVAS
VSTVLTGTK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctcgggagaacggagaggccggcggggattgctcgtggaagaagcaggtcgatgat
atcaaggagatgtttgaattcaaagaggtgcttgggacgggtgcgttctcagaggtggtc
ctggcagaggagaggtccacgggaaagatgttcgctgtgaagtgcatccctaaaaaagca
ctgaagggcaaggagagcagcatcgagaatgagattgccgttctacgcaaaattaagcat
gagaacatagtggcgttggaggacatctatgaaagctccaatcacctctacctaataatg
cagctgatggcacggtgggccacgacccagatcacagcgaactggaagatgaagaatgtc
gatctggacagagaggaagagagagggtggcagtctgctccagaagttctcgctcagaag
ccatacagtaaagctgtggactgctggtctatcggggtcattgcctacatcctattgtgt
ggttaccctcccttttatgatgagaatgactccaaactctttgagcagatcctgaaagcg
gactatgagttcgatgcgccgtactgggatgatatatctgattcagcaaaagacttcatc
agttgtttgatggaaaaggacccaacaaagcgatacacatgtgaacaggcccttcgacat
ccctggatcgcaggagacactgcgctctgcaagaacatccatgagtctgtcagtagacag
atgcgcaaaaactttgcaaaaagcaaatggagacaagccttcaacgccacggccgtggtt
cgccacatgaggagactgcagttgggcagtagcatggggagcagcatggaccaatcaaac
aacgccaaccagaaccgcatactgaacgccaaccagactccaaacaccactgcggcactt
acccaaaaccacaaacctgctcccaatgcaaacgccgttcttgttaacgatatggccacc
tctataccacgcaaagactgcactgcccctccccacacttcctgttccctggcatcaact
gcttcctcctctacctcaggggcggagccctgcaggccactccctccctcagttgcgtcg
gtgagcacagtgctaactgggaccaagtga

DBGET integrated database retrieval system