KEGG   Sinocyclocheilus grahami: 107584697Help
Entry
107584697         CDS       T04918                                 

Definition
(RefSeq) protein MRVI1-like
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107584697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 107584697
NCBI-ProteinID: XP_016126887
Position
Unknown
AA seq 1291 aa AA seqDB search
MDIQKQIQSLEVNHIPAQLEETKRGMKVLLKDQGTSTCDDAQIQFRDVAVVTDSSAERLA
AEELLESLRKVEDVVSQALRAAQVLMGSEERIEAIGMRVEKALSRAEATESQLSALEATI
SANTQSFCMSQSEATGLLVDRSSAAVMSFSTPEPVAQESILTPLSSENGGSLLHTPAEEH
SNQVSQNPDATLLDQDPGSPSELWRRRAVRVCYEPVSTGLPSVGALTLQSPALICTESSL
PGPSACEEPTPHNRQENVAGLDRPASNDIFLSESEAIRNTLAVKEETCRSLNKVETGCAG
TELQNSRRQIESSGKCQKSEHSSRTEALKLLNQGQPSKSADVWDNQGFNSSGETQVEETG
SCQEGRGDLECTGRSQAESKSSGQSQARTGNSETQEERKTSDSETSKNPSVQGEDLTDTP
GDQEDPSAVCQFTRSRGEQTSLKRAHSFVTKSVTPFIFPHTRSQPLLIPTMPTLPEEEED
SPEELDSTSSSPSTYAPVESKRVNVTMTPPAIVLPRQVSKQEPCPLEKASPRPRLSRNSA
SSCPITAVDDDGHVIDLVKDQLPELQLSEEDRQKNLELLEEAKKVSDRFLQRRGRRSTCS
LSESPTALSPNPTPCSSPRPSRSSSLSSPSQLGPEVTSTPPGSPSIAKHLEVPSTHDQGD
TTKPEQETFTRLVDWMPSDKRKVSSGTLTPRYATTVPARDPAVVQKEKPDHHAPADKGKN
SEHAAQKKEETSGCGISQPPATGVAKPVPRPPTQQAPCTAEIKTIGAFPPLMRAVSWDTV
GSMNMRNTAPKGEDNLSDKSRESLFKSSGYKDFPVPPGSVQKLSKLREEHKLMRNQSISS
SKLPDLNETTEQERGPSSPLTSSPSEEEAKEKPDAMPNISDVMLRKLKLHRGLPGCAPPL
SEKEVENAFVQLSLAFRNDNYTLESRLKQAERERNLTEENTEKELEEFKNTLKNTVSLWQ
NMEQREFYQHLFETIAVLHRLANRLSSRAEMVGAVRQEKRMNKATEVMMQYVENLKRTYE
KDHAELMEFKKLASQNSSRCYAGSVDTGEDGVPRTSRSMSVQMGKALPRRRVSVAVVPKF
NLLNIPGQTPAAAGPNVAPGALPVVCEVNTIKNSSSSDPTQQDVPDKSSGNPLTEQESEA
MPTKVVCSPEKITEEIKAKIEEAAYNKGFQEGLKRSKELQELKEEEEKAEEKQKDSEEEA
RGNTDKDRKTNSRFEEALEVFDRIFPKFFRRNRVLWIVLTLFFASFILVNVISFFSNRYS
ESGDTSAEKSAVPGKKTFFGLNVGSKTPAPE
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggacattcagaagcagatccaaagcctggaagtcaatcacattccagcccagctggaa
gagactaagcgtggcatgaaggtgcttctcaaagaccagggaacgagcacctgtgacgac
gctcagattcagtttagggacgtggctgtggtcactgattcatcagcagagcgtttggct
gcagaagagctgctggagtctctgaggaaagtggaggatgtggtttcgcaggccttgcgg
gcagctcaggtgctcatgggcagcgaggagaggatagaggccatcggcatgagggtggag
aaagcactgagcagagcagaagctactgagagtcaactcagtgccctggaggccaccatc
tctgctaacacacagtcattctgtatgtctcaatccgaggccaccgggctcctggtggat
cgtagctcagccgccgttatgtccttttccacacccgaacctgtcgctcaggagagcatc
ctcactccactttcatctgaaaacggtggctcacttctgcacacgccagcagaggaacac
agcaaccaggtcagccaaaacccagatgcaaccctcctagatcaggatcctggttcacca
tctgagctttggcgtagacgtgctgtcagagtttgctacgagccagtgtctaccggtctt
ccatctgtgggagcgcttaccctacagagtcctgctttaatctgtactgagagctctttg
ccgggaccgtcagcttgtgaggagcccacgccgcacaacagacaggagaatgtagctggg
ttagaccggccagcaagcaatgacatcttcctctcagagtcagaggctattaggaacacc
ttagctgtaaaggaggaaacgtgcaggagtctaaataaagtagagactggatgtgcagga
actgagctacaaaacagtagaagacaaatagagagttctgggaagtgccaaaaatcagaa
catagcagcaggacagaggccttaaaacttctgaaccaagggcagccttccaagtcagcg
gacgtctgggataatcaaggattcaattcatcaggggagacccaagtagaggagactggg
agttgtcaagagggaagaggagatttagaatgcactgggaggagtcaagcggaatccaaa
agcagtggacagagtcaagcaaggacagggaacagtgagactcaagaggaacgcaaaaca
agtgactcagaaacatcaaagaatccaagtgtccaaggtgaagatctaactgacactcca
ggggaccaagaggacccctctgctgtatgtcagttcacacgctcacggggtgagcaaact
tcactaaagagagctcatagctttgtgacaaagtctgtcactccttttatcttccctcac
acacgctctcagcccctgctcatccccaccatgcccactcttcctgaggaagaggaagat
tccccagaggagctcgacagtacatccagttcgccctccacatatgctccagttgaaagc
aagagggtgaatgtaaccatgactccaccagctattgtgcttccaagacaagtcagcaag
caagagccctgtcctctggagaaagcaagccctaggcctcgtctctcccgaaactctgca
tcttcatgtcccatcaccgcagtggatgatgatggacacgtgatagacctggtgaaggat
cagcttcctgagctgcagttatctgaagaggatcgtcagaagaatctggagctgctcgag
gaggccaagaaagtcagcgatcgcttcctgcagcgcagaggccgacgctccacctgtagt
ctcagtgaatctccaacagctctctctccaaacccaacgccatgctcctcccccagacca
tccagaagcagttccctctcctcaccctcacagctaggtcctgaggtcacctcaactcct
ccaggtagtccctccatagctaagcatctggaggtaccatctacccatgaccaaggggac
accactaaaccagagcaggagaccttcacgaggctagtagattggatgcccagtgacaag
cgaaaggtatcctctgggactttaaccccgcgttatgccaccactgtaccagccagagat
cccgctgtggttcagaaggagaagccagaccatcatgcaccagcggacaaggggaagaac
tctgaacatgcggcccagaaaaaggaagagacttctggctgtggcatcagtcaacctcca
gctacaggagtagccaaacccgtcccccggccacctacacagcaagccccatgcacggcc
gaaatcaaaacaataggggccttccctcctctgatgagagccgtctcctgggacacggtg
ggctccatgaacatgaggaatacagctcccaaaggggaggacaatctctcagacaaatca
agggagtctctgtttaagtcctccgggtacaaggacttccctgtgccacctgggagcgtt
caaaaactgtccaaattgcgcgaggagcacaaactgatgcgtaaccagagcatctccagc
tcaaagcttcctgacctgaatgaaacgaccgagcaggaacgaggtccatcctctccgctc
accagctctcccagtgaagaggaggccaaagagaaacctgacgctatgcccaacatttca
gacgtcatgctacgcaaactcaaactgcacagaggtttacctggatgcgcacccccgctc
tcagagaaggaagttgagaacgcttttgtgcagctttcgctggcattccgcaacgacaat
tacacgctggagtcgcggctgaaacaggcggaaagggagcgcaacctgactgaggaaaac
acggagaaggaactggaagagtttaaaaacactctcaagaacactgtgtcactgtggcag
aacatggagcagcgagagttttaccagcacctcttcgaaacgatcgccgtattgcaccgc
ctggccaaccgcctctccagccgggctgaaatggtgggagctgtgagacaggagaagaga
atgaacaaggccactgaggtgatgatgcagtacgtggagaatctgaagcggacgtatgag
aaggaccatgctgagctgatggagtttaagaagcttgccagccagaactccagccgctgc
tatgcaggatcagtggacactggagaggatggtgttccacgtacatcaagatccatgtct
gtgcaaatgggaaaggctttgcccagacgaagagtcagtgtggctgtagttcccaagttt
aatctactgaacatccccgggcagacgccagctgccgctggccctaatgttgcacccggt
gcacttcctgtggtgtgtgaggtgaacaccattaagaacagcagttcctcagaccctaca
caacaagatgtgcctgacaaatccagtggaaaccctctgacggagcaggaaagtgaagca
atgccaaccaaagttgtctgcagtccagagaagattacagaagagatcaaagccaagatt
gaagaagcagcatataacaaaggattccaagaaggacttaagaggtctaaagaacttcag
gagctgaaggaggaggaagagaaagcagaagagaagcagaaggactctgaggaggaagca
agaggaaatactgataaagacaggaagactaatagcaggttcgaggaggcattagaggtc
tttgaccggatattcccaaaattcttccggcgaaatcgagtgctttggatcgtcctcact
ctgttttttgcttcattcattcttgtcaatgtcataagcttcttcagtaaccgctacagt
gagagcggagacacatctgcagagaagtccgccgtcccaggcaagaagacgtttttcgga
ctgaatgtagggtcaaagacccctgccccagaatga

DBGET integrated database retrieval system