KEGG   Sinocyclocheilus grahami: 107584862
Entry
107584862         CDS       T04918                                 

Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107584862
Ion channels [BR:sgh04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107584862
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 107584862
NCBI-ProteinID: XP_016127106
Position
Unknown
AA seq 500 aa
MKTSVMDLKVEPMDIDYDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWLVFFLSSLT
FLMYVCVDRIQFYLEYPHVTKLDEITTPLMVFPAVTICNLNSIRFSRITRNDLYHAGELL
ALLDSRHEIRDAHLVEESVMEVLKSKADFHSFKPRPFNMWEFYNRTGHDIKDMLLSCQFR
GSPCRPEDFSVVFTRYGKCYTFNSGNTGAPLVSVKGGMGNGLEIMLDIQQDEYLPVWGET
DDSSFEAGIKVQIHSQDEPALIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPS
SDYFKAYSISACRTDCETRYLVENCNCRMVHMPGDAQYCTPVLYKECAHPALDFLVERDS
DYCSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKYITENVLVLDVFFEALNYE
TIEQRKAYEVAGLLGDIGGQMGLFIGASVLTILELFDYLYEVMKYRLCRCSDKKHHNNNN
TDHGTVLGLDDVKCHVSKFH
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaagacatcagtgatggatcttaaagtggaacctatggacattgattacgaccagccg
cctcccctccaagtgttcgctcacacctcgactctacacggcatctctcatatcttctcc
tatgagaagatcacggccaaatgctgcctctggctggtgtttttcctcagctccttgacc
tttctcatgtatgtctgcgtcgatcggattcagttctacctggagtaccctcacgtcacc
aagctggacgagatcacgacgcccctgatggttttcccagcggtgacgatttgcaatctc
aactccatccgcttcagcaggatcacacgcaacgacctgtaccacgcgggcgagctgctg
gcactgctggactccagacatgagatacgggacgctcacctggttgaagaaagcgtgatg
gaggttctcaagagcaaagcagactttcactccttcaagcctcgacccttcaacatgtgg
gagttctataatagaacaggacacgacataaaagacatgctgctctcctgccagttcaga
ggttcgccgtgtcgacccgaagacttcagcgtggtgttcacgcgttacgggaagtgttac
acctttaactcgggtaacaccggcgcgccgctggtcagcgtgaagggagggatgggaaac
ggcctggagatcatgctggacattcagcaggacgaatatttacctgtgtggggagagaca
gacgactcgtcatttgaggccggaatcaaagttcagattcacagtcaggacgagcctgca
ttaatagatcagctgggcttcggagtcgcaccaggattccagacgttcgtttcttgccaa
gagcagcgactggtgtatcttcctgctccgtggggcagctgcaagtcaaccccgccgagc
tcagactacttcaaagcgtacagcatcagcgcctgtcgaacggactgcgagacacgctac
ctggtggaaaactgcaactgccgcatggtgcatatgcctggtgatgcgcagtactgcact
cctgtgctatataaagaatgtgcacatccagcactagatttcctggtggagagggacagt
gactattgctcatgcgagactccgtgcaacatcacgcgctacagtaaagagctgtccttc
gtcaagatccccagcaaagcatcagtcaaatatcttgcaaagaagtacagcaaatctgag
aaatacataacggagaatgttctagtgctggacgtgttctttgaggctctgaactatgaa
accattgagcagaggaaagcctatgaggtggctggtctgttgggtgatatcggaggacag
atggggctgttcattggagccagtgttcttacgattttggagctttttgactacctttat
gaggtaatgaaatacaggttgtgccgctgctctgacaagaagcatcacaacaacaacaac
actgatcacggcactgtactcggcctggatgatgttaaatgtcacgtcagtaaattccat
taa

DBGET integrated database retrieval system