KEGG   Sinocyclocheilus grahami: 107585112Help
Entry
107585112         CDS       T04918                                 

Definition
(RefSeq) inositol hexakisphosphate kinase 2-like
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107585112
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     107585112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK GCIP CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 107585112
NCBI-ProteinID: XP_016127468
Position
Unknown
AA seq 431 aa AA seqDB search
MSPALEALIKGCRYPGKGEMKGGVMLEPFVHQVGGHSCVLRFGEQTICKPLIPREHQFYK
SLPPEIRKFTPQYKGVVSVSFEEDEEGNLCLIAYPLHSDPADLENKEPSADGEPKNKLVK
WGKKKPSGLLPENERARQSRKEEKGKSNRDDKAEVLYYSLEKGNVVPQIKHNPWSLQCHQ
QHLQRMKENSKHRNQHKFILLENLTWRYRVPCVLDLKMGTRQHGDDASEEKKANQIRKCQ
QSTSSSIGVRLCGMQMYHSATGQLIFMNKYHGRKLSLAGFKEALCQFFSDGRVLRRELLT
PVLQRLREMRAVLEACESYRFFSSSLLIIYDGAPPPAPSRSRPSRGGEEEDEEDDDEDED
DDDEEGAYGGRRDHSGSASPMVDVRMIDFAHTTCRDYGEDGIVHEGGDSGYIFGLQNLIS
ILSQLEEHSND
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggctttagaagcgctgataaaggggtgtagatacccagggaaaggagaaatg
aagggaggagtgatgttggaaccatttgtccatcaagtcggcggccactcttgtgtactg
cggtttggggaacagaccatctgtaaaccactaatacccagagaacaccagttttacaag
agcctgccacccgagatccgcaaattcacgccacagtacaaaggtgtggtgtcggtgagt
tttgaggaagatgaggaggggaatctgtgtttgatagcatacccactccacagtgatcca
gctgatttggaaaacaaagagccctctgctgatggcgagcccaagaataagctcgttaag
tgggggaaaaagaaaccatcaggcctattaccagaaaacgagagagccagacagagtcgc
aaagaggagaagggcaaaagtaatcgggatgataaggcagaggttttgtactacagtctg
gagaaaggaaacgtggttcctcagatcaaacacaacccttggagtctgcagtgtcaccag
cagcacctacagaggatgaaggagaactccaaacacagaaaccagcacaaatttattctt
ctggagaatctaacatggcggtaccgggttccatgcgttctcgatctgaagatgggaaca
cgtcagcatggggatgatgcctccgaggagaagaaagcaaaccagattcgcaaatgccaa
caaagcacttcctcttctattggagtacgcctctgtggcatgcagatgtatcacagtgct
acagggcagctgatattcatgaacaagtatcacgggcgtaagctgagtctggccgggttt
aaagaggctctgtgccagttcttcagtgacggccgagttctgcgcagagaacttctgacc
ccagtgctgcaaagactgagagagatgagagcggtgctggaggcttgcgagagctatcgt
ttcttctcctcctctcttctcatcatctacgacggggctccaccccctgccccatctaga
tcccggccctctcgaggaggagaggaggaagatgaggaggacgatgatgaagatgaggat
gacgacgatgaggagggagcctacggagggcgtcgcgatcactccggcagcgcttcacca
atggtggacgtccgaatgatcgatttcgcccacacaacgtgtcgtgattatggagaggac
ggcattgttcatgaaggtggagacagcggctacatcttcggcctgcagaacctcatcagc
attctgtcacagcttgaagagcacagcaatgactaa

DBGET integrated database retrieval system