KEGG   Sinocyclocheilus grahami: 107585261Help
Entry
107585261         CDS       T04918                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A isoform X1
  KO
K03254  translation initiation factor 3 subunit A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107585261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sgh03012]
    107585261
Translation factors [BR:sgh03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    107585261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 107585261
NCBI-ProteinID: XP_016127691
Position
Unknown
AA seq 1240 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVIKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTETAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSKVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFALSKKPPKPQLMANYYNKVSTVFWKSGNALFHACTLHRLY
HLSREMRKNLTPEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQSPPTRQSLINDMVRFNLLQYVVPEVKELYNWLEVDFHPLKLCGRVTKVLNWVRDQVEK
ESDLQHYVPHLQNNTILRLLQQVAQIYQSIEFSRLASLVPFVDAFQLERSIVDAARHCDL
QVRIDHTSRTLSFGSDLNYSTKEDSPVGPFLQNMPSEQIRNQLTAMSSSLAKAIQVIKPA
SILQEHEEQSQQAITSYLKNARKEHQRILARRQTIEERKERLESLNIQREKEELEQREAA
LQKVRKAEEERLRQEAKEREKERIMQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKKAYEEQRIK
DMELWELQEEERISNMKMEREKALEHKQRMSRMMEDKENFLSKIKAARSFIYEEKLKQFQ
ERLVEERKKRLEERKNQRKEDRRNAFYRQKEEDAQRIHEEQLKKEREERERLEQEQREEE
EREYQERLRKLEEQERKQRARQQEIEERERRKEEERKAPEEKPTKDWGEREEGGWRKRGE
GDSEWRRPVADREWRQEEREGREDNDREDRDREVPLRRVGEISRHGGSDDRGLRRGFDDE
RGLRRGGDDDRGPKRGFDDDRGPRRGFDDDRGPRRGDDDRGPRRGMDDDRGPRRGFDDDR
GPRRSMDEPRGPRRGADDDWFPRRGGDDERGGRRGMDDSGPRRGDDPKPWKPLGRPGVST
DGGWREREKAREESWGPPRDTGHDDGEPEGDDRHEGDRFRDRRPPREEGGGWRRGGAEEQ
SSWRDSRREEFDRDDRRERRDVRDRRDDRDNRGPQRDPDEGGSWRRGGDERKDEREAPPR
PHDRDRDGGEKSTWRSDKDKENLRRIKNETDDDGWTTVRR
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctatttccagagaccggagaacgctcttaagcgagcaaacgagtttcttgaa
gttggtaaaaagcagccagctttggatgtgctctacgatgtcatcaagagcaaaaaacat
cgaacatggcagaagatacacgagcctatcatgctcaaatacctggagctctgtgtggac
ctgcgcaagagccacttggcaaaggagggactgtatcagtacaaaaacatctgtcaacag
gtgaatatcaaatctctggaggatgtggtccgtgcttacctgaaacttgcagaagagaag
actgagacagcgaaagaggagtctcagcagatggtgctggacattgaggatctggacaac
attcagaccccagaaagtgttctgttgagtgccgtcagtggtgaagacactcaagaccgc
actgacagacttctgctcacgccttgggtaaagttcttgtgggagtcgtaccgccagtgc
ctggacctgctaaggaataactccaaagtggagcgcctttaccatgacattgctcagcaa
gcgtttaagttttgcctgcagtacacccgtaaagcagagttccgtaagctgtgtgacaac
ctgcgaatgcatctgggacagatccaacgacatcacaaccagagcactgccattaacctg
aacaatcccgagagccagtccatgcatctcgagacacgtctggtccagctggacagcgct
attagcatggagctgtggcaggaagcattcaaagcagttgaagacatccatggattgttt
gccctctcaaagaagccccctaaaccccaacttatggccaattactacaataaggtgtcc
actgtattctggaagtctggcaatgccttattccatgcctgcaccctacacagactttat
cacctctcccgggaaatgcgcaagaaccttaccccagaagagatgcagagaatgtccact
cgagtgcttttggccactttgtctattcccatcacccctgagcgtactgatatcgctcgt
ctgttggacatggatggcatcattgtagagaaacaacgcagactggctactttgcttgga
cttcagtctccacccacccgccagagtctcatcaatgacatggtgagattcaacctgctt
cagtatgttgttcctgaagtcaaagagctctacaattggttggaggtggacttccaccct
ctaaaactttgtggaagagtgactaaagtgctgaactgggtgagggaccaagttgagaaa
gaatcagacctgcagcattatgttcctcacttgcagaacaacaccatcctcagactgcta
caacaggtggctcagatctaccagagcattgagttcagcaggttagcatctctggtacca
tttgtcgatgctttccaactggagcgctcaattgtagatgcagcacggcactgtgaccta
caggtacgcatcgatcatacatctcgtacactgagttttggctccgatctgaactattct
accaaagaggattctccagtaggtccgttcctgcagaacatgccctctgaacagatacgg
aatcaactcactgccatgtcatcctccttggctaaagccatccaggtcatcaaacctgca
tccatactgcaagaacatgaggaacagagtcagcaggccatcacatcctacctgaagaat
gcccgcaaagagcatcagcgcatccttgctcgccgtcaaacgattgaggaacgcaaagag
cgtctggagagcctcaacatccagagggagaaagaggagctggagcaacgggaggcagcg
cttcagaaagtgcgcaaagccgaggaagagcgtcttagacaggaggccaaagagcgagaa
aaggagcgcatcatgcaagaacacgagcaaataaaaaaaaagacagtgcgtgagcgactg
gagcagatcaagaagactgagctgggagccaaggcctttaaagacatcgatattgaggat
ctggaagagctggaccctgacttcatcatggccaaacaggtagaacaactagaaaaagag
aagaaagaacttcaggagcgtctgaaaaaccaggaaaagaagattgactactttgagaga
gccaagcgccttgaggagattcccctgatcaagaaagcctatgaggagcagcgcatcaaa
gacatggagttatgggagctgcaggaggaagagaggatcagcaatatgaagatggagcgt
gagaaggcgctggaacacaaacagagaatgtcaaggatgatggaggacaaggagaacttc
ctgtccaaaattaaagctgctcgaagcttcatttatgaggaaaaactcaagcagttccaa
gaacgtttggttgaggagaggaagaagcgtcttgaggagcgaaagaatcagcgtaaggag
gacagacgtaatgccttctatcgccagaaagaagaggacgctcagagaatccatgaggaa
cagctcaagaaagagcgggaagagcgggaacgcttggaacaggagcaaagagaggaggaa
gaacgcgaataccaggagcgcttgcgtaagctggaggaacaggagagaaagcagcgtgcc
cgtcaacaggaaattgaggagcgtgaacgccgcaaggaggaggaaagaaaggcaccagaa
gaaaaacccaccaaggactggggtgaacgggaagaaggaggctggaggaagcgaggtgag
ggtgattcagaatggcgacgtcctgttgctgaccgtgaatggcgtcaagaggagcgtgaa
ggccgtgaagacaatgatcgagaagaccgtgaccgtgaagtgcccttgcgaagagtagga
gaaatttctcgtcatggtggttcagatgacagaggactccgccgtggttttgatgacgaa
cgaggtctgcgccgaggaggtgacgatgaccgtggacctaaacggggctttgatgatgac
cgtggtcccaggaggggctttgacgatgaccgaggaccccgaagaggcgatgacgaccgt
ggaccaaggcgtggaatggatgacgaccgtgggccaagaagaggctttgatgacgaccgt
gggccccgtagaagcatggatgaacccagagggcctcgacgtggggcagatgatgactgg
tttcccagaagaggaggggatgatgagaggggaggccgcaggggtatggatgactctggc
ccacgtcgtggagatgaccctaaaccctggaaaccacttgggagaccaggtgttagcaca
gatggtggatggagagagcgagagaaggctcgggaagaaagctggggacctcctcgtgat
actggccatgatgatggtgagcctgagggagatgaccgtcacgagggagatcgatttaga
gatcgacgtcctcccagggaagaagggggtggctggagaagaggtggtgctgaggagcag
agcagttggcgtgactctcgacgtgaagaatttgaccgtgatgatcgtcgtgaacgccgt
gacgtgagggaccgcagagatgaccgtgataacagagggccccagagagaccctgatgaa
ggtggttcatggcgtcgtggtggcgatgagcgcaaggacgaaagagaagctcctcccaga
ccacatgaccgggaccgtgatggcggtgagaagagcacctggcgctctgacaaagataag
gaaaatctgcgccggatcaagaacgagacggatgatgatggctggactactgtccgccgc
taa

DBGET integrated database retrieval system