KEGG   Sinocyclocheilus grahami: 107585435
Entry
107585435         CDS       T04918                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh00240  Pyrimidine metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107585435
   00240 Pyrimidine metabolism
    107585435
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107585435
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 AAA_17
Other DBs
NCBI-GeneID: 107585435
NCBI-ProteinID: XP_016127939
Position
Unknown
AA seq 256 aa
MSPTAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLEEYDREWEVVPEPIARWCN
VQTQHNEHEELSTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRIRSQIRSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLHLRGRDEEQGIPLEYLEKLHYKHECWLQQRTMSMEFEYLNEVPVLTLDVND
DFKDNKIKCADMIEKV
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtctcccacagccaaaagagcctgtcccagtcctctgaacgacagcctggagaaaaga
ctgaaacgcatctccattgaaggcaacattgctgcgggtaaatccacttttgttcgcctg
ctggaggaatatgatcgagaatgggaggtagtaccggagcccatcgctagatggtgcaat
gtacaaactcagcacaacgagcacgaggaattgagcacctctcagaagagtggaggaaac
gtgctgcagatgatgtacgagaagcccgagcgctgggcctacaccttccagagctatgcc
tgcatgagccgcatccgctcgcagatcagatccaccaacggaaagctgcgagaggccgag
aatccggtgcagttcttcgaacgatccgtgtacagcgacaggtacatctttgcctctaac
ctctatgaaagtgagtgtgtgaatgaaaccgagtgggcgatctatcaggactggcacagc
tggctgcataagcagtttgggaagcacattgagctggacggcatcatttacctgcgggca
aaaccagaaaggtgtttggagcgattgcatttgagaggaagagacgaggaacagggaatt
ccactggaatatctggagaaactccactataaacatgagtgctggttacagcaaaggact
atgagtatggagtttgagtatctgaatgaagtgccggttcttaccctggatgtcaatgac
gattttaaagacaacaagatcaagtgtgctgatatgattgagaaggtatga

DBGET integrated database retrieval system