KEGG   Sinocyclocheilus grahami: 107585690Help
Entry
107585690         CDS       T04918                                 

Definition
(RefSeq) septin-2-like
  KO
K16942  septin 2
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107585690
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sgh04812]
    107585690
   04147 Exosome [BR:sgh04147]
    107585690
Membrane trafficking [BR:sgh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107585690
Cytoskeleton proteins [BR:sgh04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107585690
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107585690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 Gtr1_RagA AAA_16 Ras AAA_29 AAA_22 ABC_tran Roc
Motif
Other DBs
NCBI-GeneID: 107585690
NCBI-ProteinID: XP_016128307
Position
Unknown
AA seq 333 aa AA seqDB search
ALLLFSGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRL
TVVDTPGYGDAINSQDCFNTIIAYIDDQFERYLHDESGLNRRHIVDNRVHCCFYFISPLG
HGLKPLDVQFMKAIHNKVNVVPVIAKADTLTLRERERLKRRILDEIDEHGIKIYHLPDAE
SDEDEDFKEQTRILKASIPFAVVGSNQQIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLR
TMLITHMQDLQEVTQDLHYENFRSERLKRGGRLSSHGYILPLSPVKAPEPEEMDKDIILQ
EKEAELKRMQEMIAKMQAQMQKQGDGDGESPHL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gcacttcttctgttttcaggtgagtctggtttggggaagtccactctgatcaacagtttg
ttcctcactgatctctacccagagaggatcattcctggtgctgcagagaagattgagcgc
acggtgcagatcgaggcctcgacggtggagatcgaggagcgtggagtgaagctgcgtctc
actgtggtcgacacacctggatacggtgatgccatcaacagccaggactgttttaacacc
attattgcctacatcgatgaccagtttgagcgctacctgcatgatgagagtggactcaac
cgcaggcacattgtggacaaccgtgtgcactgctgcttctacttcatttcccctctgggt
cacgggctgaagcctctagatgtccaattcatgaaggccattcacaacaaagtgaatgtc
gttcctgttattgctaaagcagatacgctgacactgagggagagagagagactcaagcgc
agaattctggatgaaatcgatgagcatggcatcaagatctatcacctccctgatgccgag
tctgatgaggatgaagatttcaaagagcagacccggattctcaaggccagcataccgttc
gccgtagtgggatccaaccagcagattgaggctaaggggaagaaagtgagagggcgtttg
tacccatggggtgtggtggaggtagaaaacccagaacacaacgacttcctcaaacttcgc
accatgctaatcacccacatgcaggacctgcaggaagttactcaggaccttcactacgag
aacttccgctcggagcgcctcaaacggggcggcaggttgtcctcccatggttatattctg
cctctgtcgcctgtgaaggctccggagccagaggaaatggacaaggatataatcttgcag
gagaaggaggctgagctgaagcgaatgcaggagatgattgctaagatgcaggcgcagatg
cagaaacagggagacggagatggagaaagcccacacctgtga

DBGET integrated database retrieval system