KEGG   Sinocyclocheilus grahami: 107586996
Entry
107586996         CDS       T04918                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107586996
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107586996
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 107586996
NCBI-ProteinID: XP_016130066
UniProt: A0A672NF60
Position
Unknown
AA seq 328 aa
MYEYLSNNCTCTYVLGAFVLLWVLVWFYRDNLEITKVSEKHVFVTGCDSGFGHLLCKCLD
KRGFRVLAGCLTEKGADDLKRATGPFLKTCILDVTSTISIQKALEWTKKEVGDKGLWGLV
NNAGRSLPMGPSEWMKIEDFQSTLKVNMTGMIEMTMNFLPLVKKARGRVVNVASVLGRVA
ANGGGYCVSKFAVESFSDCLRRDIQNFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQL
TPEVKESYGDKYLDKYIKIQRLIMNTICDSDLSKVTNCMEHALLAVHPRTRYSAGWDAKL
LWIPLSYMPACVVDIALKLVLPKPAKSV
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtacgagtacttgagtaacaattgtacatgcacatatgtcttgggtgcgtttgtgctg
ctatgggttctggtgtggttctaccgggacaacttggagatcaccaaggtctcggagaaa
cacgtttttgtgactggttgtgactctggtttcggacacctactgtgcaaatgcctggac
aaacgtggtttccgcgtcctagccgggtgtctcacggaaaagggcgcagatgatctgaag
agggcgacaggacctttcctgaagacctgcatcttggacgtgaccagcacgattagcatt
cagaaggctttggaatggaccaaaaaagaagttggagataaaggactttggggtctcgtg
aacaatgctggacgctcccttcccatgggtccatcagagtggatgaaaatcgaagacttc
caaagcacgcttaaagtgaacatgactggcatgatcgagatgaccatgaacttcttgcct
cttgtcaaaaaggcccgtggacgagtggtgaatgtggcgtcagtgttgggaagagtggca
gctaacggtggaggatattgcgtctcaaagttcgcagtggagagcttctctgattgtctc
aggagagacatccagaattttggggtcaatgtgtgcatcatcgaacctggtttcttcaag
actcaggtgaccagcttggagcccatcgagagggaacttcatcgcctctggaaccaactg
acccctgaagtgaaggagagttatggagacaaatacttggataaatacatcaagatccag
aggctgatcatgaacaccatatgcgactctgacctcagcaaagtgaccaactgcatggaa
cacgccctgctggccgtccacccaagaacacgctacagcgcaggctgggatgccaagctc
ttgtggattcccttgtcttatatgcctgcttgtgttgtagatattgcgctgaagctggtg
ttgccaaagcctgcaaaaagtgtctag

DBGET integrated database retrieval system