KEGG   Sinocyclocheilus grahami: 107587278Help
Entry
107587278         CDS       T04918                                 

Definition
(RefSeq) myotubularin-related protein 2-like
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
sgh04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107587278
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107587278
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107587278
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107587278
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107587278
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107587278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM 3-PAP Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107587278
NCBI-ProteinID: XP_016130482
Position
Unknown
AA seq 850 aa AA seqDB search
MDIKRPTSAQSNAETPDSPTGDHVEWCKQLIAATMSSQISGPISSEMISREYKDCDVEVK
EFLLDSDPQQTASSSALREGNKQAQMEEAPRVPGETIKAIVKDVMYICPFSGVVRGTLTI
TDYKLFFKSLVRDPAFVLDVNLGAISRLESIAVQSHGENTQGLEIVCKDLRNPRFAYRKE
GQSNLEVFEILSKYAFPLFHNLPLFAFKYRESFPEDGWKIYDPVAEYKRQGLPNESWIIS
KVNSSYGVCETYPALLVLPSNVTEDELKRVAAFRAKRRFPDCDVEVKEFLLDSDPQQTAS
SSVKPVELHSVVIVLQLDCNRMTEFSESMKLPNSCVTALREGNKQAQMEEAPRVPGETIK
AIVKDVMYICPFSGVVRGTLTITDYKLFFKSLVRDPAFVLDVNLGAISRLESIAVQSHGE
NTQGLEIVCKDLRNPRFAYRKEGQSNLEVFEILSKYAFPLFHNLPLFAFKYRESFPEDGW
KIYDPVAEYKRQGLPNESWIISKVNSSYEVCETYPALLVLPSNVTEDELKRVAAFRAKRR
FPAKDGGYENESFYINVELNFLEIPNIHVMRESLRKLKEVVYPAIDQQRWFSSVDSTHWL
EYIRLLLAGAVRIADRIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDAHYRSLRGFQVLL
EKEWLSFGHRFASRVGHGDGNHANSERSPLFVQFIDCVWQMTRQFPSAFEFNELFLITVL
DHLYSCLFGTFLYNSEQERVSKEVYSKTVSLWSYVNSQLEEFTNPLYVNYEHHVLYPVAS
LRHLELWVSYYVRWNPRMRPQVPVHQSLKELLVLKSELQMRVDELKREAASSQSISSSSE
HEGMPMQTTV
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggatattaagcgaccgacctcagcacagtctaacgctgaaactccagacagtcccaca
ggggatcatgttgagtggtgtaaacaactgattgcagccacaatgtcaagtcagatctct
ggacccatcagctcagaaatgatttccagagagtacaaggactgtgatgtggaggttaaa
gaatttctcttggacagtgaccctcagcagactgcctcctcttcggcactcagagaagga
aataagcaggctcagatggaagaggccccacgcgttcctggagaaaccatcaaagctatt
gtcaaggacgtcatgtatatctgtccgttctctggggtcgtgaggggaactctaaccatc
actgactacaagctcttctttaaaagcctggtgcgggatcctgcgtttgtgctggatgtg
aatcttggagccattagcagactggagtctatcgccgttcagagtcatggagagaacact
caagggcttgagatcgtttgcaaggacttgagaaacccccggtttgcgtacaggaaggag
ggacagagcaatttggaggtgtttgaaatactgtcaaagtacgcattccctctcttccac
aacctgcctctctttgcctttaagtaccgagagtcatttccagaagatggctggaagatc
tacgacccagtcgctgagtataagaggcagggtcttccaaacgagagctggatcatcagt
aaagtcaacagcagttacggggtgtgcgagacgtatcccgctctgctggtccttccttca
aacgtcacagaggacgaactgaagagagtggcggcctttagggccaaacgccgtttccca
gactgtgatgtggaggttaaagaatttctcttggacagtgaccctcagcagactgcctcc
tcttcggtcaagcctgttgaactccacagtgtcgtcattgtcctgcagctggactgtaat
agaatgactgaattctctgagtccatgaagctgccaaacagttgtgtcactgcactcaga
gaaggaaataagcaggctcagatggaagaggccccacgcgttcctggagaaaccatcaaa
gctattgtcaaggacgtcatgtatatctgtccgttctctggggtcgtgaggggaactcta
accatcactgactacaagctcttctttaaaagcctggtgcgggatcctgcgtttgtgctg
gatgtgaatcttggagccattagcagactggagtctatcgccgttcagagtcatggagag
aacactcaagggcttgagatcgtttgcaaggacttgagaaacccccggtttgcgtacagg
aaggagggacagagcaatttggaggtgtttgaaatactgtcaaagtacgcattccctctc
ttccacaacctgcctctctttgcctttaagtaccgagagtcatttccagaagatggctgg
aagatctacgacccagtcgctgagtataagaggcagggtcttccaaacgagagctggatc
atcagtaaagtcaacagcagttacgaggtgtgcgagacgtatcccgctctgctggtcctt
ccttcaaacgtcacagaggacgaactgaagagagtggcggcctttagggccaaacgccgt
ttcccagccaaagatggaggatatgagaatgagagtttctacatcaatgtggaactgaac
tttctggagatccccaacatacacgtgatgagagaatccctgaggaaactgaaggaggtg
gtgtatcctgccatcgaccaacagcgctggttctcatctgtggactctacgcactggctg
gaatacatcaggctcttgctagcaggtgcggtgcgcatcgcagaccgaatcgagtctggt
aagacgtcagtggtggtgcactgcagcgatggctgggaccgcacggctcagctcacctct
ctggccatgctcatgctggacgcacactaccgctcgctcaggggcttccaggtgcttctg
gagaaggagtggctgagcttcggacaccgctttgcctcacgtgtgggacatggagatggg
aatcatgcaaactctgagcgctcgcctctctttgtgcagttcatcgactgtgtctggcaa
atgacccggcagtttccctctgcgtttgaattcaacgagctatttctcatcacggtgctt
gatcacctgtacagctgcctgttcgggacgtttctttacaacagcgagcaagaacgagtc
tcgaaggaggtgtacagcaagaccgtgtctctgtggtcatatgtgaacagccagcttgag
gaatttaccaacccgctgtatgtgaactacgagcaccatgttttatacccagtagccagt
ttgagacatttagagctttgggtcagttattatgtgcgctggaaccctcgcatgaggcca
caggttcctgttcatcagagtctgaaggagttgttggtcctgaagtcggagttgcagatg
agagtggatgagttaaaacgagaagcagcttcatcacaatctatctcctcttcctcagag
catgaaggaatgcccatgcagactactgtctga

DBGET integrated database retrieval system