KEGG   Sinocyclocheilus grahami: 107587920Help
Entry
107587920         CDS       T04918                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107587920
Membrane trafficking [BR:sgh04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107587920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 107587920
NCBI-ProteinID: XP_016131366
Position
Unknown
AA seq 2085 aa AA seqDB search
MATLPSERRAFAHKINRTVASEVRKQVSREYGSPQLSKKRAGAHQMVPLTEVVEPVDYEE
YVSSHPPGAEPGPLRQLLEFPSDDLELLLQERECATIEPPVPEEDSLDPRVRDALGVYTD
NWLIIQRKYQRYSTTQTPHNSERQREKQKGLVKQTFELDEAAIDRHDEQDDSKRHSVSLD
DTPRGSWASSIFDLKNSTPDALLPSVLERTAAEDMDCRNAENRQQCRHADLLGLYPAPDE
DEAVERCAIPEVPKEHSGQRIMVKCLSLKFEIEIEPIFGSLALYDVREKKKISEDFHFDL
NSDQMKSLLRPHSPHAAISTLARSTIFSITYPSPDIFLVIKLEKVLQQGDIGECCEPYMV
MKESDSTKHKEKLEKLRAQAEQMCTRLGRFRMPFAWTAIHLLNIVSSVGGLDRSDSDSDT
ERKGTWNERKKKGFERMSVGEDMCNFTNFRPATLTVTNFFKQEGDRLSDDDLYKFLADMR
RPSSVLRRLRPVTAQLKIDISPAPEAPHYCLSPELLHVKPYPDPRVRPTKEVLEFPARYV
YTPHTTYRNLLYVYPQSVNFSSRQGSVRNIAVKVQFMAGEDPSQAMPVIFGKSSCAEFYE
AAYTPVIYHNKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGYTWIP
LMQHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVKAASSVHTQ
DPHLDKFFTLVYVLEEYSFPFRLKDVIITEANVEAELKASMAALKGALLDTCVRFLHQLM
SKLILLIVHPPVIAGQIVNLGRAAFEAMALLVNQIHKNLEGNQDHLGHNNLLSSYIHYCF
HLPTTEPVSPPAVGAASYDLPIQYATLSRAMARPSSLLLSRSKSLSNSNPDLASTPATPD
EEVQRIIGSKGIDRSHSWVNSAYAPGGSRAVLRRNPNSSCELKQLLHEELALQWVVSTST
VREASLQQAWFFFQLMVKSMSHHLFLSSRLDMPRRQRFPDRFVDDIAALVCAISADIASR
YHKDVELVERLNSSLAFFLNDLLSLMDRGFVFNLFRSYYKQINNKLHTAQSPSSLTALRM
DFIRIVCSHEHYVTLNLPCATLSPPASPSPSTSSTTSQSSAFSCHVQDQGVVSMFELSVP
FRQQHFLSGLLLAELSLILEPDGEGVFFLHKKAISALHSLLCSHDADPRYTDPQVRSHIA
QLYLPLIPIVMETLAQLHDFTDTSPQRVRHASALVDDSDPDNGTISQSVAMVIAGSPLPH
SKANPFTLPSVVGRQCSALSTECSRTLLVCFLWVLKNADAGLLERWVSDLSVPQINRLLD
LLHLCLSCFEYKGKKALQRINSLTFKKSQDMKARLEEAILGTIGARQEMVRRCRERSPYG
GQENVRWRKNVTHWRQNADRVDKTKAELEQESVVDGNLATEAALIALDTLEIIVKTVVMS
ELKESVLGGVLRVLLHSMAGNQSALFLQHCFSTQRALVYKFPEMLFEEDTELCADLCLRL
LRHCSSSVSSVRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSMKFNEEHLR
RSLKTILTYAEDDLELRDSPFPEQVQDLAFNLHMILTDTVKMKEHQQDPEMLIDLMYRIA
KGYQNSPDLRLTWLQNMAGKHSERGNHAEAAHCLVHSAALVAEYLNMLEDCRYLPIGCVS
FQSISSNVLEESAVSDDILSPEEEGICSGKYFSESGLVGLLEQAAASFNMAAMYEAINGL
YKILCPIHEANRDFKKLASVHGKLQDAFNKVYNQSSGWERMFGTYFRVGFYGCRFGDLDG
QEFVYKEPSITKLAEISHRLEEFYSERFGDEVVVIIKDSNHVDKNKLDPNKAYLQITYVE
PFFDTYELKERITYFDKNYNLRTFMYCTPFTLDGRAHGDLHEQYKRKAILTTSHAFPYIK
TRINVIHKEEIILMPMEVAIEDMQKKTQELAFATQQDPADSKMLQMVLQGCVGTTVNQGP
LEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYHRELERN
YTKLREALFPLINRKIPQLYRPLPLPTTLTQRNSLSRSSFRRVEC
NT seq 6258 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttacccagcgaacggagggcttttgcgcataagattaacaggacagtagcg
tctgaggtcaggaagcaggtttcccgggaatatggctctccgcagctgtccaaaaaacgt
gctggagctcatcaaatggtgcctctgacggaggtggtggagccggtggactatgaggag
tatgttagcagccatccgccaggagcggagcccggacctctccgacagctgctggagttc
cccagcgatgacctggagctgctgctgcaggagagagagtgcgccacgatagagccgccc
gtcccggaggaggactcactggaccccagagtgagggatgccctgggggtctacaccgac
aactggctcatcatccagaggaagtatcagcgatacagcacaacacagacgcctcacaac
tctgagcggcagagggagaaacagaaaggactcgtcaaacaaacctttgagctggatgag
gccgccattgatcggcatgatgagcaggatgactcaaagaggcactcggtgtcgttggat
gacacgccgcggggtagctgggcctccagtatatttgacctgaaaaactccactcctgat
gcgctgctgccttctgtgctggagcgcacggctgcggaggacatggactgtcgcaacgcc
gaaaaccgccagcagtgccgccacgctgatctgctgggactttaccctgcgccggatgag
gacgaggccgtcgagaggtgcgccatcccagaggttcccaaagagcacagcggccagagg
atcatggtcaagtgtttgtcgctcaaatttgagatcgaaatcgagccaatatttggatca
ctggctctgtatgatgtcagagaaaagaaaaagatttcagaggattttcactttgacctg
aactcggatcagatgaagagcttgctgcgaccccacagtccacacgcagccatttccaca
ctggcgcgatccacgatcttctccatcacatacccgtctccggacatcttcctagtcatt
aagttggagaaagtccttcagcaaggagacatcggcgaatgctgtgagccgtacatggtc
atgaaggaatccgactccactaagcataaggaaaagctggagaagctgagggctcaggct
gagcagatgtgcactaggctgggtcgtttccgcatgccctttgcctggactgcgattcat
ctgctgaacatcgtcagcagtgttggaggcctggaccgctccgattcagactcagacacg
gagcgtaaggggacgtggaatgagagaaagaagaaaggatttgagaggatgagtgtagga
gaggacatgtgcaactttactaacttccgtccagcgactctcactgtcaccaatttcttc
aaacaggaaggggacagattgagtgatgatgacttgtataagttcctggcagacatgagg
agaccatcgtctgtcctgcgtcgactcagacctgtgactgctcagctgaagatagacatc
tccccggctccagaggccccacactactgtctgtctccagagctgcttcatgtgaagcct
taccctgacccacgtgtgcgccccaccaaagaagtgctggagtttcccgctcgctacgtc
tacaccccacacactacctacaggaacctgttgtacgtttaccctcagagtgtcaacttc
agtagccggcagggttcggtgaggaacattgcagtgaaggtgcagttcatggcaggagag
gatcccagccaggccatgcctgtcatctttggaaagtcaagctgtgcagagttttacgag
gcggcgtacaccccagtgatctaccataacaagtccccggagttctatgaggaggtaaag
atgaagattcccgccaacctcaccgacaaccaccacctgctcttcaccttctatcacatc
agctgccagcccaagcagaatacccccttggagacgccggtgggctacacgtggatcccc
ctcatgcagcacggccgcctgcgcaccggctccttcagtctgcccgtctctgtggagaaa
cctccacccagctactcagtcctcactcctgacgtacagctaccagggatgaaatgggtg
gacaaccacaaaggagtctttaatgtagaggtgaaggcagcctcctcagttcacacacag
gatccacacctggataagttcttcacacttgtgtatgttctggaggagtactctttccct
ttccggctgaaggatgttataatcactgaggcaaacgtggaggcggagctgaaggccagc
atggcagctttgaaaggggcactgctggacacttgcgtgcgcttcctgcatcaactgatg
agcaagctcatattgctaatcgtacaccctcctgtcatagcaggacagatcgtaaatcta
ggccgtgctgcttttgaagccatggccctgctggtaaaccagatccataagaacctggag
ggaaaccaggaccatcttggccacaacaatctgctgtcctcctatatccactactgcttc
cacctgcccacaacagagcctgtatctccccctgctgtgggagccgcatcgtatgatctc
cccatccagtatgccacgctctctagggcgatggcaagacccagcagcctgctcttgtcc
cgctccaagagcctgagtaactccaaccctgacctggcctcaactccagccacccctgac
gaggaggtgcagagaatcatcggcagcaaggggatagaccgctcacattcctgggtaaac
tctgcttatgctccagggggctcaagggcagtgctccgtcggaaccccaactccagctgt
gagctcaagcagttacttcatgaagagctggctctccagtgggtggtgagcaccagtacc
gtgagagaggcgtctctacagcaggcctggttcttcttccagctcatggtgaagagcatg
tcccatcatctgttcctgtcctcacgcctggacatgccccgacgccagcgcttcccagac
cgctttgtggacgacatcgctgccttagtgtgtgccatcagtgcagacatagccagcaga
tatcacaaggatgtcgagctagtggagaggttaaacagcagcttggcctttttcctcaat
gacctgctgtctctcatggacagaggctttgttttcaacctcttccgctcgtattataaa
cagattaataataagctccacacagcgcagagccccagctctctgacagcgctgaggatg
gacttcatacggatcgtctgcagtcacgagcactacgtcaccctgaacctgccctgcgcc
accctcagtccccccgcgtccccctcaccctccacatcctccaccacctctcagagctca
gcgttctcctgtcatgttcaggatcagggtgtggtcagcatgttcgaactgtcggtgcca
ttccgccagcagcattttctttctggtctgcttttggctgagctgtcactcatcctggag
ccagatggagagggtgtgttcttcctacacaagaaggccattagtgcgctgcattctctg
ctgtgcagtcacgacgcggacccccgctacacagacccccaggtccgctcgcacatcgcc
cagctctacctgccactcatccctatcgtcatggagacgctggcccagcttcacgacttc
accgacacgtccccacagcgtgtacgtcatgcctcggcgctcgttgacgatagcgaccca
gacaatggcaccatcagccagtctgttgccatggtgatagctggttcaccactcccccat
tccaaagccaaccccttcactctgccgtctgtggtgggccgtcagtgtagtgccctctct
accgagtgcagcaggacactgctggtttgtttcctgtgggtgttgaagaatgcagacgct
gggctgttggagcgctgggtctcagacctgtctgtgccacaaatcaaccgcttgcttgat
cttcttcacctctgtctgtcctgtttcgaatacaagggaaagaaagccctgcagaggata
aacagtctgacctttaagaagtctcaggacatgaaggcccgtctggaggaggccatactg
ggcaccatcggagcaagacaggagatggtccgtcgctgcagagagcgcagtccttacgga
ggtcaggagaacgtccgctggaggaaaaacgtcactcactggagacagaacgcagacaga
gtggacaaaaccaaggcagagttggagcaggagtcggtagtggatggaaacttggcgaca
gaagctgctctcatagccctggacacactggagatcattgtcaaaacggtggtaatgtca
gagctgaaggagagtgttttgggtggtgtgctgagagtcctcctccacagtatggcagga
aaccagagcgccctcttcctgcagcactgcttcagcacacagagagctttggtctacaag
ttcccagagatgctgtttgaggaggacactgagctctgtgctgatctgtgtttgcggttg
ctgcggcactgcagcagcagcgtgagctccgtacgcagccacgccagcgcctccctctac
ctgctcatgagacagaactttgagatcggcaacaatttcgcccgtgtcaagatgcaggtt
accatgtctctgtcttcactcgtgggaacctcgatgaagttcaatgaagagcatttgcga
cgctctttaaaaactattctcacatatgccgaggatgacctggagctcagagattccccc
ttccctgagcaggtgcaggatctcgccttcaacctccacatgattctcactgacactgtg
aagatgaaggagcaccagcaggacccagagatgcttatagacctcatgtacaggattgct
aagggctatcagaactctcctgatctgaggctcacgtggctgcagaacatggcagggaag
cactccgagagagggaaccacgcggaggcagcacactgtctagtgcatagcgccgccctt
gtggcggagtacctcaacatgcttgaagattgccgctacctccctatcggatgcgtgtca
ttccagagtatttcgtccaatgtgctggaggagtctgcggtgtctgatgatattctgtcc
ccagaggaggagggcatctgttcagggaagtacttcagtgagtctgggctcgtgggactt
ctggagcaagcagctgcttctttcaacatggctgccatgtacgaggccataaatggactc
tacaaaatcctttgtcccattcatgaggccaacagagactttaagaagctagcctccgtc
cacggcaaactgcaggatgccttcaacaaagtatacaatcagagctcaggatgggagagg
atgtttggcacctacttccgtgttggcttctatggatgccgctttggagatctggacggg
caggagtttgtctataaagagccttccatcaccaaactagctgagatctcacatagactg
gaggaattttactctgaacgatttggtgatgaagtggtggtgatcatcaaggactccaac
catgttgacaagaacaaactggaccccaataaggcgtacctgcagatcacatatgtggag
cccttcttcgacacttacgagctgaaggagcgcatcacttactttgacaagaactataac
ctgcgcacgttcatgtactgtacaccgttcacgctggacggtcgggcccacggcgacctg
catgagcagtacaaacgcaaggccatcctcaccacctcccacgccttcccctacatcaag
acccgcatcaacgtcatccacaaagaggagatcattttgatgccgatggaggtggcgatt
gaggatatgcagaagaagacacaggagctggccttcgcaacccagcaggaccccgctgac
tcaaagatgctccagatggtgcttcagggttgtgttggcaccactgttaatcagggtccg
ctggaggtggctcaggtcttcctgtctgaaattcctgaggaccccaaactcttccggcat
cacaataaactgcgcctctgcttcaaggacttcactaaaaggtgtgaggatgctctgagg
aagaacaagtctctgatcggtccagatcagaaggagtaccatcgagagctggagcggaac
tacactaaactgagagaagctctgtttcctcttatcaaccggaaaatccctcaactctac
agaccactgcctctgccaaccacactaacacagaggaattctctcagtcgatccagtttt
cggcgggtggagtgctga

DBGET integrated database retrieval system