KEGG   Sinocyclocheilus grahami: 107588586Help
Entry
107588586         CDS       T04918                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03040  Spliceosome
sgh04010  MAPK signaling pathway
sgh04141  Protein processing in endoplasmic reticulum
sgh04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107588586
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107588586
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107588586
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107588586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107588586
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sgh03041]
    107588586
   03009 Ribosome biogenesis [BR:sgh03009]
    107588586
   03110 Chaperones and folding catalysts [BR:sgh03110]
    107588586
   04131 Membrane trafficking [BR:sgh04131]
    107588586
   03051 Proteasome [BR:sgh03051]
    107588586
   03029 Mitochondrial biogenesis [BR:sgh03029]
    107588586
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107588586
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107588586
Spliceosome [BR:sgh03041]
 Complex B
  Other components
   Prp19 complex
    107588586
 Complex C
   Prp19-CDC5 complex
    107588586
Ribosome biogenesis [BR:sgh03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107588586
Chaperones and folding catalysts [BR:sgh03110]
 Heat shock proteins
  HSP70 / DNAK
   107588586
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107588586
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107588586
Proteasome [BR:sgh03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107588586
Mitochondrial biogenesis [BR:sgh03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107588586
Exosome [BR:sgh04147]
 Exosomal proteins
  Proteins found in most exosomes
   107588586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG FGGY_C DDR MetOD2 HORMA
Motif
Other DBs
NCBI-GeneID: 107588586
NCBI-ProteinID: XP_016132218
Position
Unknown
AA seq 649 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNTRPKVQVDYKGETKSFYPEEIS
SMVLTKMKEIAEAYLGKTVSNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKVEDDVQRDKVSSKN
GLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKEVE
KVCNPIITKLYQSAGGMPGGMPDGMPGGFPGAGAAPGGGSSGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggaccagctgttggtattgatctcgggaccacctactcctgtgtaggtgtt
ttccaacatggaaaagttgaaatcattgctaatgaccaaggaaacaggaccactccaagc
tatgtagctttcacagatagtgagagattgattggagatgctgcaaaaaaccaggtcgcc
atgaaccccaccaacacagtctttgatgccaagcgtctgattggtcgcaggtttgatgat
ggcgttgttcagtctgatatgaagcactggccttttaatgtcatcaatgacaatacccgt
cccaaggtccaggttgactacaagggggagaccaagtctttctaccctgaagagatttcc
tccatggttctcaccaagatgaaggaaatcgctgaggcctacctgggaaagactgtttcc
aacgctgttgtcacagtgcctgcctacttcaatgattctcagcgacaggccaccaaggat
gctggaaccatctctggattgaatgttctgcgtatcatcaatgaaccaactgctgctgct
attgcttacggtctggacaaaaaggttggtgctgagaggaatgtcctcatcttcgatctt
ggtggtggcactttcgatgtgtctatcctcaccattgaggatggcatcttcgaggtcaaa
tctactgctggagacactcacttgggtggggaagactttgacaatcgcatggtgaaccac
ttcatcacagagttcaagcgcaagcacaagaaggacatcagcgacaacaagagagccgtt
cgccgtctccgcactgcctgcgagagggcgaagcgtaccctgtcctccagcactcaggcc
agtattgagatagattccctctatgagggtatcgatttctatacctccatcaccagggcc
cgttttgaggagctcaatgctgacctcttccgtggcaccttggacccagtcgagaagtca
cttcgtgatgccaagatggacaaggctcagatccacgacattgtcctggttggtggctcc
actcgcattcccaaaatccagaagctgctccaagactacttcaacggcaaggagcttaat
aagagcatcaaccccgatgaggctgtggcctacggagcagccgttcaggctgccatcctc
tctggtgacaagtctgagaatgttcaggacttgctgctgctagatgtcactcctctgtcc
cttggaattgagacagctggtggagtcatgacggtcctcatcaagcgtaataccactatc
ccaaccaaacagactcagactttcaccacctattctgacaaccagccaggtgtgctcatt
caggtctatgagggtgagcgtgctatgaccaaggataacaacttgctgggcaagtttgag
cttactggaatcccccctgcacctcgcggtgttccccagattgaggtcacctttgacatt
gatgccaatggcatcatgaatgtttcagctgttgataagagcactggcaaggagaacaaa
atcaccatcaccaacgataagggtcgtctcagcaaggaggacattgagcgcatggtgcag
gaggcagagaagtacaaggttgaggatgatgtgcagcgcgacaaggtgtcttccaagaat
ggtctggagtcatatgccttcaacatgaagtccactgttgaggatgagaaactaaaggga
aaaatcagtgatgaggacaagcagaagatccttgacaagtgcaatgaagtcattagttgg
cttgacaagaaccagactgctgagaaggaagagtttgagcaccagcagaaggaggtggag
aaggtatgcaaccccatcatcaccaagctgtaccagagtgctggaggcatgccaggtgga
atgcctgatggtatgcctggtggcttcccgggagctggcgccgctccaggaggtggatcc
tccggcccaaccattgaggaggtcgactaa

DBGET integrated database retrieval system