KEGG   Sinocyclocheilus grahami: 107590360Help
Entry
107590360         CDS       T04918                                 

Definition
(RefSeq) cAMP-responsive element modulator-like
  KO
K09052  cAMP response element modulator
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107590360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107590360
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107590360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Phage_Gp23 Rh5 DUF4988
Motif
Other DBs
NCBI-GeneID: 107590360
NCBI-ProteinID: XP_016134554
Position
Unknown
AA seq 108 aa AA seqDB search
MAVTGDETESATTGGMSAYQIPSPVSGLSQAMDGSPGSLPSPQQLTEGASRKRELRLMKN
REAARECRRKKKEYVKCLENRVAVLEKQNKMLIEELKALKDLYCHKTE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgactggagatgagacagaatcagccaccactggaggtatgtctgcatatcag
attccctctcccgtatctggcctttcccaggcgatggacggctctcccggttctctgccc
agccctcagcagctgactgagggagcatcacgcaagagggaactccgacttatgaaaaac
agggaagctgcccgggaatgtcgccggaagaagaaagaatatgtcaaatgtctcgagaac
cgagttgccgtgcttgaaaaacaaaacaagatgcttattgaagaactcaaggctcttaaa
gacctatactgtcacaaaaccgaataa

DBGET integrated database retrieval system