KEGG   Sinocyclocheilus grahami: 107590844Help
Entry
107590844         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04068  FoxO signaling pathway
sgh04310  Wnt signaling pathway
sgh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107590844
   04310 Wnt signaling pathway
    107590844
   04068 FoxO signaling pathway
    107590844
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107590844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107590844
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107590844
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107590844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 107590844
NCBI-ProteinID: XP_016135250
Position
Unknown
AA seq 411 aa AA seqDB search
MAFHGSSRPTVCGNLFPGSDLGHKYFCVNTTTGTTSTGLSATPNPTGPNAPAGTPRHPAS
LGGSAGGGAAIPQPHSNPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGEFTWAYVTFGLHSSFFLILGIWMNVHKMLSPIQQLDLIT
DLLGTPPLSAMASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVFDPAK
RISGSDALSHPYLDEGRLRYHTCMCKCCYSVPSGRVYTRDFEPPADRPFSHNYEQSMHSV
WQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctttccatggatcctctcggccaacagtgtgtggtaacttgttccctggatcagac
ttaggccacaagtatttttgtgtgaacaccacgaccggcactacctcaacgggcctcagc
gcaacaccaaatccgactggacccaacgctcccgctgggactcccagacacccggcgtct
ctcgggggcagtgcaggcggaggtgcggccatcccacaacctcacagtaacccagcaagt
gaggttccaagtcctgctgaaatggagcctgatcggcctatcggttatggtgcatttggg
gtggtctggtctgtgacggaccctcgggatggacgtaaggtggctctgaagaaaatgccg
aatgtcttccagaacctggtctcctgcaaacgtgtgttcagggaactccggatgctgtgt
ttctttaaacatgacaatgtgctgtctgcccttgacattctccaacctccacaaatcgac
tgctttgaggagatatacgtgatcactgagctcatgcagagtgacctacataaagtcatc
gtttcccctcagcctctcaccaccgatcacatcaaggtgttcctctaccagatactcagg
ggtgagttcacatgggcatatgtcacttttggattacattcttctttttttttaattttg
ggaatctggatgaatgtacataaaatgttgagccccatacaacagttggatctgatcact
gatctcctcgggactcctcctctttctgccatggcatccgcctgtgaaggagcacgagcg
cacattcttagaggaccccacaaaccaccctcgctgtctgttctgtacatgttgtcagat
ggcgcaacacatgaagctgttcatcttttgtgccgcatgctagtttttgatccagctaag
cgcatctcgggcagtgacgctctgtctcatccgtatttggatgagggtcgtctgcggtac
cacacctgcatgtgtaagtgctgttactctgtgcccagcgggagggtgtacacccgagac
tttgagccgcctgcggatcgacctttcagccacaactatgagcagagcatgcactccgtc
tggcaaggcaaagagctcatccatcgttttataacagagcaccagcaaggcaaacgagtg
cctttgtgcatcaatccccagagtgcagccttcaaaaccttcattagatccacagcctgg
cattcctcaaaagtatcaaggaaagaagagagatga

DBGET integrated database retrieval system