KEGG   Sinocyclocheilus grahami: 107591787Help
Entry
107591787         CDS       T04918                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00561  Glycerolipid metabolism
sgh01100  Metabolic pathways
Module
sgh_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107591787 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgh01002]
    107591787 (mgll)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107591787 (mgll)
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S33
   107591787 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Peptidase_S9 Abhydrolase_2 Chlorophyllase2 Lipase_3 LIDHydrolase PGAP1 Abhydrolase_5 DUF1350 PAF-AH_p_II Peptidase_S15 Thioesterase Abhydrolase_3 DUF1057
Motif
Other DBs
NCBI-GeneID: 107591787
NCBI-ProteinID: XP_016136525
Position
Unknown
AA seq 343 aa AA seqDB search
MNEIPGMHMLATCLLVAAVSYWYSSELLTALRLFISDSALGGDMPEPEGNRLSPQGVPYT
DLPHIVNADGLHLFCRYWEPDSQPKALVFVAHGAGEHCGGYADIAHSLTQHGILVFAHDH
VGHGQSEGERMDIKNFQIYIRDALQHIDIMKGRYPNLPVFIIGHSMGGSISILTACERPQ
DFAGVVLIGPMVQMNAESATPFKVFLAKILNRLTPKLSLGSIESKWVSRDPKQVEAYDAD
ELNHHGGLRVSFGMQLMDAAARIKRELPNITWPFFILHGDADKLCDIGGSHLMYNEAKST
DKKLKVYEKAYHALHHDLPETVESVLKKVCTWILERLPSPHGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaattcccggaatgcatatgctagccacctgcctattagtcgctgctgtttca
tactggtacagcagcgagcttctgacagcgctccgtctgtttatttcagactcagccctc
ggcggggacatgccggaacccgaggggaatcgtctgtcaccgcaaggtgtcccttacacc
gacctgccgcacatcgtcaacgccgacggactgcacctgttctgccgttactgggagccc
gacagtcagccaaaggcgctggtgtttgttgcccacggagcaggagagcactgtggggga
tatgctgacattgctcacagcctgacccagcatggtattctggtgttcgcccacgatcac
gttggtcatggccagagtgaaggtgagagaatggatatcaaaaactttcagatttacatc
agagatgccctccagcacattgacatcatgaagggccggtaccccaatctgccagtcttc
atcattggacactcaatgggagggagcatttccattctgaccgcgtgtgagaggccgcag
gattttgcaggtgtggttctcataggccccatggttcaaatgaatgctgaatctgctaca
cctttcaaggttttcctggcaaaaattctaaaccgcttgactcccaaactctctcttggt
tcaatcgaatcaaaatgggtctcacgggatcccaaacaggtggaggcatatgacgcagat
gagctaaatcatcatggagggctgcgtgtctcgttcggaatgcagctgatggatgcggcg
gctcgcatcaagagagaattacccaacattacatggcccttcttcattctccatggagac
gccgacaagctttgtgacattggagggtctcatctaatgtataatgaggccaagagcact
gataaaaaactgaaggtgtatgaaaaagcctaccatgccctacatcatgatttacctgaa
acagtagagtctgtcttaaagaaggtgtgcacttggatcctggagagactccccagccct
catgggtcttag

DBGET integrated database retrieval system