KEGG   Sinocyclocheilus grahami: 107592380
Entry
107592380         CDS       T04918                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107592380
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107592380
Peptidases and inhibitors [BR:sgh01002]
 Metallo peptidases
  Family M1
   107592380
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107592380
NCBI-ProteinID: XP_016137363
Position
Unknown
AA seq 1220 aa
MTRFVLLVNLIVLPVHLWAAVTQEHTSFPTSVNGEPFPWNKMRLPDTVSPLHYHLLVHPN
LTSLDFTGWVQIQIEVHENTRTIILHSKDLHISNARLLGSDKGQLQALKVLEYPYFQQIA
LISDNALLKRGHVYSVELEFAANLSESFHGFYKSTYRSNKGDVRVVASTQFEPTSARAAF
PCFDEPDFKANFSIRIRREAKHIALSNMPKLRTLELPDGLFEDQFDVSVKMSTYLVAFIV
SDFLSISKMSLHGVQISVYAVPEKIDQAEFALDAAVKLLDFYDDYFDIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESALLFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQWWND
LWLNEGFAKFMEFVSVNITNPELQVEDYFLGKCFEAMEVDSLSSSHPVSTPVENPAQIQE
MFDDVSYDKGACILNMLREFLTPDAFKLGIVRYLKRYSYQNTVNSNLWESLTNVCDSDGL
DEGRMKGDESCRRSVSHSGASKWHSEDELDVKAMMETWTLQEGFPLITVEVRGREVRLSQ
ERYLKSDDPSQTSRVYAVENVLAIEIALYIPLPKQDLAAIPDFQSGAMENWGLTTYRESA
LLFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQWWNDLWLNEGFAKFMEFVSVNITN
PELQVEDYFLGKCFEAMEVDSLSSSHPVSTPVENPAQIQEMFDDVSYDKGACILNMLREF
LTPDAFKLGIVRYLKRYSYQNTVNSNLWESLTNVCDSDGLDEGRMKGDESCRRSVSHSGA
SKWHSEDELDVKAMMETWTLQEGFPLITVEVRGREVRLSQERYLKSDDPSQTSSFLWHVP
LTYITSGSTTVQRFLLKTKTDVLYLPEEVDWIKFNVDMSGYYIVHYEGSGWDDLITLLKH
NHTALSSNDRASLINNAFQLVSVGKLPLDKALDLTLYLSKETEIMPVTQGFSELVPLYKL
MEKRDMVELENQMKGYILQLFRKLIDQQSWTDDGSVSQRMLRSYLLMFGCVRGHPPCVST
ATHLFNQWRDSDGNMSLPNDVTMAVFSVGARTEDGWEFLFEKYKESMYVSMKNRIKMALT
TSPLDHKLKWMIEQSLVGEVMKTQDLPYVVTSVSKNPKAYKHAWDFLKANWDALIKKFDL
GSHSIAHMVVGVTNQYSTREMLAEVRRFFSSLRAETGAELRCILQALENIEENIRWMDKN
LPLLKAWLHRQYDQHKNTEL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgactcgctttgttctgcttgtgaatctcatagttctgcctgttcacctttgggctgca
gtcactcaagagcacacttcattccccacatcagtcaatggagaaccattcccatggaac
aaaatgagacttccagacacagtatctccccttcattaccatctccttgtgcaccccaat
cttacaagtttagactttactggatgggtgcagatccaaattgaggtccatgaaaacacc
aggactatcatactgcacagcaaggatcttcatatctccaatgcaaggttgctaggttca
gacaaaggtcagctacaggccctgaaggtgctagagtacccatacttccagcagattgcg
cttatatctgataatgcactgctgaagaggggccatgtatattcagttgaactggagttt
gccgccaacctctctgaaagctttcatggattttacaaaagcacgtaccgcagcaacaaa
ggagacgtcagggttgtggcctccacacagtttgagccgactagtgcccgggcagccttt
ccctgttttgatgaacctgacttcaaagcaaacttttccatacggattcgcagagaagca
aagcatattgccctctcaaacatgcctaagctgagaacattagagctgccagacggcctg
tttgaggaccagtttgatgtgagtgtaaagatgagcacatacctggtggccttcattgtc
tctgactttctgtctatcagcaagatgagtctgcatggagtccagatttcagtgtatgct
gtgccagagaagatcgaccaggcagagtttgctctggatgctgcagtgaagctgctcgac
ttttatgatgactactttgacattccgtaccctctacccaaacaggatcttgctgctatc
ccagacttccagtctggagcaatggagaattggggcctgaccacctaccgggaatcagcc
cttctttttgacccccacaagtcttctgcttctgacaagctgggcatcacgatgatcatc
gctcatgaactggcccatcagtggtttggtaaccttgtgaccatgcagtggtggaatgat
ctgtggctgaatgaaggttttgccaagttcatggagtttgtgtctgttaacatcaccaat
cctgaactgcaagttgaggattatttcttggggaagtgtttcgaggccatggaggtagac
tccttaagctcctctcacccagtgtccacaccggtggagaaccctgctcagatacaggaa
atgtttgatgatgtttcctatgacaagggggcttgtattctgaacatgctgagagagttc
ctgaccccagatgccttcaaactgggcattgtgagatacctaaaacgctacagttaccag
aatacggtcaatagtaacctgtgggaaagtctgaccaatgtgtgtgactctgatggtctg
gatgagggcagaatgaagggtgatgagtcttgccggcgctcagtctcacactctggagct
tctaaatggcactctgaggatgagctggatgttaaggctatgatggagacatggacattg
caggagggctttccactcattacggtggaggtcagaggtcgcgaagtcagactaagtcaa
gagcgttacctcaagagtgatgacccctcacaaacatctagggtttatgctgttgaaaat
gtgcttgcaattgagatagcgctgtacattcctctacccaaacaggatcttgctgctatc
ccagacttccagtctggagcaatggagaattggggcctgaccacctaccgggaatcagcc
cttctttttgacccccacaagtcttctgcttctgacaagctgggcatcacgatgatcatc
gctcatgaactggcccatcagtggtttggtaaccttgtgaccatgcagtggtggaatgat
ctgtggctgaatgaaggttttgccaagttcatggagtttgtgtctgttaacatcaccaat
cctgaactgcaagttgaggattatttcttggggaagtgtttcgaggccatggaggtagac
tccttaagctcctctcacccagtgtccacaccggtggagaaccctgctcagatacaggaa
atgtttgatgatgtttcctatgacaagggggcttgtattctgaacatgctgagagagttc
ctgaccccagatgccttcaaactgggcattgtgagatacctaaaacgctacagttaccag
aatacggtcaatagtaacctgtgggaaagtctgaccaatgtgtgtgactctgatggtctg
gatgagggcagaatgaagggtgatgagtcttgccggcgctcagtctcacactctggagct
tctaaatggcactctgaggatgagctggatgttaaggctatgatggagacatggacattg
caggagggctttccactcattacggtggaggtcagaggtcgcgaagtcagactaagtcaa
gagcgttacctcaagagtgatgacccctcacaaacatctagctttctgtggcacgttcca
ttgacttacattaccagcggctcaacaacagtgcaacgcttcctgcttaagaccaaaaca
gacgtgctgtatctgccagaggaggtggactggatcaagtttaatgtggacatgagtgga
tattacattgtgcactatgagggttctggctgggatgacctcatcacgttgcttaaacac
aatcacacggcgctcagcagcaatgaccgggccagcctcatcaacaacgccttccagctg
gtcagtgttgggaagcttcccctggataaggctttagacctgaccctgtatctaagcaaa
gagactgagattatgccagtgacacagggcttcagtgagcttgtgcctctgtacaaactg
atggagaagagagacatggtggagctggagaatcagatgaagggctacatactgcagctg
ttcaggaagctcatagaccagcagtcgtggactgatgatggctctgtgtctcagaggatg
ctgcgcagctacctcctcatgtttggctgtgtgcggggtcatcctccctgtgtcagcacc
gctacacacctcttcaaccagtggagggactccgatggcaatatgagtcttcccaatgac
gtgactatggctgtgttttctgttggcgcccggactgaggatggctgggagttcctgttt
gagaagtacaaggagtctatgtatgtctcgatgaagaacaggataaagatggccctcacg
accagccctctcgatcacaagctaaaatggatgatagagcagagtctggtgggagaggtg
atgaagactcaggatcttccatatgttgtgacttcagtcagtaaaaatcctaaggcctac
aaacacgcatgggactttttaaaagctaactgggacgctctaataaagaagtttgatctt
ggctcacactctatagcgcacatggtagtaggagtgaccaaccagtattccaccagagaa
atgctagctgaggttcgtcgtttcttcagttccttgcgggctgagactggagcagaactg
agatgtattctgcaagccttggagaacattgaagagaacattcgctggatggacaagaac
ctccccctactgaaggcctggctgcacagacagtatgaccagcacaaaaatacagagctg
tga

DBGET integrated database retrieval system