KEGG   Sinocyclocheilus grahami: 107595208Help
Entry
107595208         CDS       T04918                                 

Definition
(RefSeq) annexin A11-like
  KO
K17095  annexin A7/11
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107595208
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107595208
  Exosomal proteins of other body fluids (saliva and urine)
   107595208
  Exosomal proteins of colorectal cancer cells
   107595208
  Exosomal proteins of bladder cancer cells
   107595208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Peptidase_M9_N
Motif
Other DBs
NCBI-GeneID: 107595208
NCBI-ProteinID: XP_016141038
Position
Unknown
AA seq 429 aa AA seqDB search
MSYPGYPPAGGSYPPASGPYQQAPGGYPPQPGAYPPQGGYYTPQPGAFPPGAGYPPQAGG
YPAQAGGYAPQAGGYPPQAGGYPAAPGGGFPPQAGGYPAAQPGTYPNMPPAAGGWGAQPG
FGAPGGGMPQGYPGVPAPGQQPMPVYPGASNPSMPGYGGGVPTGPTPPAAPAVNKGYRGT
IKDFPGADPLRDVEVLRKAMKGFGTDENAIIELLGSRPNKQRVPLKAAYKTTYGKDLVSD
LKSELRGNFESLVLAMLKAPAHFDASELREAISGAGTDEACLIEILSSRSNAEIREITKI
YKAEYGKSLEDAISGDTSGHFRRLLVSLSQVQTLIMCIVSNHVPSVYFSVKCIKNTPAYF
AERLHKAMQGAGTKDRTLIRIMVSRSEVDMLDIRQEYLRLYGMSLYTAISGDTSGDYKKL
LLKLCGGSD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagttaccccggataccctcctgcaggtggaagttacccgcctgcctccggcccgtat
cagcaggccccaggcggatatccaccccaaccgggagcctaccctccccagggcggatac
tacacccctcagcccggcgcgttcccccccggagcgggataccccccccaggccggcgga
taccctgcccaggccggcggttacgccccccaggccggcggttaccctcctcaggccggc
ggttacccagctgccccgggaggaggcttcccgccccaggcaggaggttaccccgccgcc
cagcccgggacctaccccaacatgccccctgcagcaggtggatggggcgcccaacccggc
tttggagctccgggtggaggaatgcctcagggttaccccggggtcccagcgccgggacag
cagcccatgccagtgtacccgggtgcttcaaacccgtcaatgcctgggtacggagggggt
gtcccgaccggaccgacaccaccggccgctcctgctgtcaataagggttaccgcggtacc
atcaaggactttcctggcgccgatccgctccgagacgtcgaggtgttacggaaagccatg
aagggcttcggaaccgatgaaaacgccattatcgagcttctcggcagtcgacccaacaag
cagcgcgtgccgttgaaggcggcgtataaaaccacttacggcaaggatctggttagcgac
ctgaagtcggagctgagaggaaactttgaaagtctggtgctggccatgctgaaggctcct
gcgcacttcgatgcctctgaactcagggaggccatatcgggtgcaggaaccgatgaggcc
tgtctcatagagattctgtcctctcgtagcaatgctgagattcgtgagattactaagatc
tataaagcagagtacggtaaatctctggaggacgccatcagcggagacacgtctggacac
tttcgccgtctgctcgtctctctgtctcaggtacagacactcataatgtgtatagtttct
aatcatgttccatctgtgtatttttcagtgaagtgcattaaaaacactcctgcctacttt
gctgaacgtctccacaaagccatgcagggtgcaggaaccaaagaccggactctgatccgc
atcatggtgtcccgctctgaggtggacatgctggatatcaggcaggagtatctgcggctg
tacgggatgtcgctctacactgccatctctggagacacctctggtgattacaagaaactg
ctcctgaagctatgcggaggaagtgactga

DBGET integrated database retrieval system