KEGG   Sinocyclocheilus grahami: 107595594Help
Entry
107595594         CDS       T04918                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    107595594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sgh03021]
    107595594
Transcription machinery [BR:sgh03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     107595594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD DZR DUF3716 zf_UBZ IBR
Motif
Other DBs
NCBI-GeneID: 107595594
NCBI-ProteinID: XP_016141531
Position
Unknown
AA seq 118 aa AA seqDB search
MSCFSGDLNFCRDCGNILPVPGRENTITCPRCSFKIPVREFTGQVIKSSVVFNPLDQSSS
TADREEDAELKGPVIDRRCSRCNREGMVYHTRQMRSADEGQTVFFTCIHCRFQEKEDS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgttttagtggtgatctcaacttttgccgggattgtgggaatattcttccagtg
cctggcagggaaaataccattacctgcccacggtgctctttcaaaatccctgttcgagaa
ttcacaggtcaagttattaaatcatcggtggtgtttaatcctctggatcagagctccagc
actgctgaccgcgaagaggatgctgagctgaaggggcctgtgattgacaggagatgttcc
cgctgtaacagagaaggaatggtgtatcacacaagacagatgagatctgcagatgaagga
cagacggtcttcttcacatgcatacactgcaggtttcaagaaaaggaagattcatga

DBGET integrated database retrieval system