KEGG   Sinocyclocheilus grahami: 107596705Help
Entry
107596705         CDS       T04918                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00511  Other glycan degradation
sgh00600  Sphingolipid metabolism
sgh01100  Metabolic pathways
sgh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107596705
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107596705
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107596705
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107596705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 CAP Glycoamylase
Motif
Other DBs
NCBI-GeneID: 107596705
NCBI-ProteinID: XP_016142989
Position
Unknown
AA seq 444 aa AA seqDB search
MRPFGRTLEPSLRITLNPSQKYQRIKGFGGAMTDAAAMNILSLSSGAQDQLLRQYFSPDG
IEYRFVRVPMASCDFSTRLYTYADTPEDYDLQNFTLAEEDIHMKIPLLQRAQALSAQPLN
LFASAWSAPAWLKTNGALIGKGSLKGKPGGKEHKTWAQYYIRFLEEYGKYNLSFWGLTSG
NEPTAGEMTNYSFQALGFTPETQRDWIALDLGPGLHSSSFPQTRLMILDDNRLLLPHWAK
VVLSDVQAARYVHGIGFHWYLNNIAPPGITLTTTHHLYPEYFLFATEACAGWSPLDRGVR
LGSWDRAENYAHDIIEDLNDFVTGWTDWNLALNQDGGPNWVKNFVDSPIIVDSSKDVFYK
QPTFYSMAHFSKFLWEGSQRVGVSFSQHTSLEISAYIRSDASAVLIILNRSEEEVQFEVW
DQTLGFLPGSAPPHSILTLLWSRR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcggccatttggtcgcactctggagccctctctcagaatcactctgaatcccagtcag
aagtatcagcgcattaaaggattcggtggagccatgacagatgcagcagctatgaatatt
ctgtccctgtcctccggagctcaggaccagctgctcagacagtacttctccccagatggt
atagagtaccgtttcgtgagagtgccgatggccagttgtgatttctcaactcgcctctac
acgtacgctgacactccagaagactacgatctccagaacttcaccctggctgaagaggat
attcacatgaagattcccctgctgcagcgggcacaggctctctctgctcagcctctcaat
ctgtttgccagtgcttggagcgcccccgcctggctgaagaccaatggtgcactgattggc
aaaggctccctcaaaggcaagccaggaggcaaagagcataagacctgggcccagtactac
attagatttctagaggaatatgggaaatataatctttctttctgggggttgacatcagga
aacgagcccactgcaggtgaaatgacaaattacagttttcaggctttgggttttactccg
gagacacagcgcgactggatcgccctggatctgggtccaggactccattcctcatccttt
ccccagacccgcctcatgatcctcgatgacaaccgacttctgcttccacactgggccaaa
gtggttctgagtgacgtacaagcggcacgttacgtccatgggattggttttcactggtat
ctgaacaacattgcgccacctggcatcaccctgacaacaacgcatcacctctacccagag
tacttcctgtttgctaccgaagcgtgtgctgggtggagtccgctggatcgtggggtgcgt
ctgggcagctgggacagagcagaaaattatgcacatgacatcatagaggacctgaatgac
tttgtgactggctggacagactggaacttggcccttaatcaggatggagggccaaattgg
gttaagaactttgtggacagccctattattgtggactcaagtaaagacgtcttctacaag
cagcccaccttctacagtatggcccacttcagcaagttcctgtgggaggggtcacagaga
gtgggcgtgtccttcagtcagcacaccagcctggaaatttctgcctatatcagatctgat
gcctcagccgtgctaatcattctcaacaggtctgaagaagaggtgcagtttgaagtttgg
gatcaaacgctgggcttcctgccaggaagtgctccacctcactccatcctcacactactg
tggagcagacgctga

DBGET integrated database retrieval system