KEGG   Sinocyclocheilus grahami: 107597742Help
Entry
107597742         CDS       T04918                                 

Definition
(RefSeq) annexin A4-like
  KO
K17095  annexin A7/11
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107597742
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107597742
  Exosomal proteins of other body fluids (saliva and urine)
   107597742
  Exosomal proteins of colorectal cancer cells
   107597742
  Exosomal proteins of bladder cancer cells
   107597742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Peptidase_M9_N
Motif
Other DBs
NCBI-GeneID: 107597742
NCBI-ProteinID: XP_016144402
Position
Unknown
AA seq 477 aa AA seqDB search
MVSEMSYPGYPPAGGSYPPASGPYQQAPGGYPPQPGAYPPQGGYYPPQPGAYPPGAGYPP
QAGGYPAAPGGGFPPQAGGYPAAQPGTYPNMPPAGQSGGWGGQPGFGAPGGGMPQGYPGV
PAPGQQPMPMYPGALNPSMPGYGGGVPTGPTPPAAPAVNKGYRGTIKDFPGADPLRDVEV
LRKAMKGFGTDENAIIELLGTRSNKQRVPLKAAYKTTYGKDLVSDIKSEVKGDFEDLVLA
MLKAPAHFDASELKEAISGAGTDEACLIEILSSRSNAEILEINKVYKAEYGKSLEDAISS
DTSGHFRRLLVSLSQGNRDEKETVDISLAKQEAQKLHAAGENKVGTDESQFNAILCARSK
PHLRQVFHEYQQMCGKDIEKSICSEMSGNVESGMVAVVKCIKNTAAYFAERLHKAMQGVG
TKDRTLIRIMVSRSEVDMLDIRQEYLRQYGKSLYTAISGDTTGDYKKLLLKLCGGSD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagagatgagttaccccggataccctcctgcaggtggaagttaccctcccgcc
tccggcccgtatcagcaggccccaggcggatacccgccccaaccgggagcctatccaccc
cagggcggatactacccccctcagcctggagcgtatccccccggagcagggtacccaccc
caggccggcggttacccagcagccccaggaggaggctttccgccacaggcaggaggttac
cccgccgcccaacccgggacctaccccaacatgccccctgcaggccagtccggtggatgg
ggcggccaacccggctttggagctccgggtggaggaatgcctcaggggtaccccggggtc
ccagcgccgggacagcagcccatgccaatgtacccaggtgccctgaacccgtcaatgccc
gggtatggagggggtgtcccgaccggaccgacaccaccggccgctcctgctgtcaataag
ggttaccgcggaaccatcaaggactttcctggcgccgatcctctcagagacgtcgaggtg
ttacggaaagccatgaagggcttcggaaccgatgaaaatgccattatcgagcttctcggc
actcgatccaacaagcagcgcgtgccgttgaaggcggcgtataaaaccacttacggcaag
gatctggttagcgacataaagtcagaggtgaaaggagactttgaagatttggtgctggcc
atgctgaaggctcctgcgcactttgatgcctctgaactcaaagaggccatatcgggtgca
ggaaccgatgaggcctgtctcatagagattctgtcctctcgtagtaatgctgagattctg
gagattaataaggtgtataaggcagagtacggtaaatctctggaggacgccatcagcagc
gacacgtctggacacttccggcggctgctcgtctctctgtctcagggtaatcgagatgag
aaagagactgtggacatttctctggccaaacaggaagctcagaaactccacgctgcagga
gagaataaagtcggcacggacgagtctcagtttaatgcgattctgtgcgctcgcagcaaa
cctcatctgagacaagtgtttcatgagtaccagcagatgtgcggcaaagacattgagaag
agcatctgcagtgagatgtctggaaacgtggagtctggaatggtggcagtggtgaagtgc
attaaaaacactgctgcatactttgctgaacgtctccacaaagccatgcagggtgtggga
accaaagacaggactctgatccgcatcatggtgtcccgctctgaggtggacatgctggat
atcagacaggagtatctgcgtcagtacgggaagtcgctctacactgccatctctggtgac
acgactggcgattacaagaaactgctcctgaagctgtgtggaggaagtgactga

DBGET integrated database retrieval system