KEGG   Sinocyclocheilus grahami: 107598049Help
Entry
107598049         CDS       T04918                                 

Definition
(RefSeq) arginase-1-like isoform X1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00220  Arginine biosynthesis
sgh00330  Arginine and proline metabolism
sgh01100  Metabolic pathways
sgh01230  Biosynthesis of amino acids
Module
sgh_M00029  Urea cycle
sgh_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107598049
   00330 Arginine and proline metabolism
    107598049
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     107598049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 107598049
NCBI-ProteinID: XP_016144779
Position
Unknown
AA seq 337 aa AA seqDB search
MKSFRGIRAAFHIFSRDLHHHHCVGIIGAPFSKGQQRDGVQRGADLIRAAGLVQKLKGQG
CVVKDYGNLIFEDIPNDEPIGRLKTPRAVGRANELLAGAVLKIKSDGNTCVMLGGDHSLA
IGSISGHAASRHELSVLWVDAHADINTPLTTPTGNIHGQPLSYLIHELHSKIPIIPHFSW
LKPCVAAKDIVYIGLRDVDPEEHYILKHLGIKMFSMTEVDRLGIAKVMEQTCDHMFSKVK
KPIHLSFDIDALDPSVSPATGTPAAGGLTYREGIYITEHICQTGLLSAVDMVEVNPKQGK
TEDEIKSTVNAAVDLILSCFGRVREGSHEPDYQIPNP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcttcagaggaattcgagccgcttttcacatattctcaagagacctccatcat
catcactgtgtgggaataataggtgctcctttttctaaaggacagcagagagatggtgtg
cagagaggagcagacctcattcgagctgctggattggtgcagaaacttaaagggcaaggt
tgtgtagtgaaggattatgggaatctgatttttgaggacattcccaatgatgagcccatt
ggcagactgaagactccgagagcagtcggccgtgccaatgagctgctcgcaggagctgtg
ctgaagatcaagagcgatggcaacacttgtgtgatgctgggaggagatcacagcttggcg
attggttcgatctctggtcatgccgcctcaagacatgagctgagtgttttatgggtagat
gcacacgcagacatcaacacgcctttaaccacaccaacgggaaacattcacggccaaccg
ctgtcgtacctcatccatgaactgcactcaaagattcccataattccacatttctcatgg
ttaaagccttgtgtagcagctaaggacattgtctacattggactcagagatgtagaccca
gaagaacattatatcctgaagcaccttggaatcaaaatgttctccatgacagaggttgat
aggcttggaatagcaaaagtaatggagcagacgtgtgatcacatgttttcaaaggtgaaa
aaacccatccacctcagttttgacattgatgcactggatccatcggtctcacctgcaaca
ggcacacctgcagcgggaggactgacctacagagagggcatttatataactgaacacatc
tgtcagacaggccttctctctgctgtagacatggtggaagtgaacccaaagcagggcaaa
acagaggatgaaattaaatcaacagtaaacgctgctgtggatctgatactgagctgcttc
ggacgggtccgcgaggggtctcatgagcccgattaccaaattccaaatccataa

DBGET integrated database retrieval system