KEGG   Sinocyclocheilus grahami: 107598251Help
Entry
107598251         CDS       T04918                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh01100  Metabolic pathways
sgh04270  Vascular smooth muscle contraction
sgh04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107598251
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107598251
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107598251
Enzymes [BR:sgh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107598251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB TMEM126 DUF1043
Motif
Other DBs
NCBI-GeneID: 107598251
NCBI-ProteinID: XP_016145019
Position
Unknown
AA seq 677 aa AA seqDB search
MFCAKLKDLKIAGECPFSMVVGKEEPADFEESAAVNAVPVSREVQGNLSNILPRRKISRS
KVNLHSLGESIRKLVCPEFDKLRNALIRVMKQQIDMSCPAACSSDVSQIVDNAEQLSDVM
RNYSLKTEIPMDTLKTSLGLEVFQDCYEEDGHILRVVGGALHDFLNSFNVLLKQSTPPTP
EVQRYIQQASILCLDKDPGLLTVYFFNPLPTTELFFSGIIQAAACWLYCTRVEVRMEVGG
KDSGALQANHQPHLLYSVFVRDGKSLTPSPMRTHSSGDIPLSLLYSTFPFHVLLDQDMGL
MQIGDGLRRRLGRCRDGQRTPVFLEHFAIVSPEIRASFQDILTMLNTQFVLRVKQHGASS
ADSPGKHMDLKGQMIFMSEMSALLFLGSPCVDKLEELTGRGLYLSDIPIHNALRDVVLVG
EQTKAQDGLKKRLSKAKAALEQAHQALEEEKRRTVELLFTIFPGNVAQRLWQGLPVPAKK
FDHVTVLFSDIVGFTAICSRCTPMQVVNMLSELYTRFDHHCGELDVYKVETIGDAYCVAG
GLHKESPTHAEQIALMALKMMDLSDEVTTPMGEVIKMRIGIHSGSVLGGVVGVKMPRYCL
FGNNVTLANKFESCSLPRKINVSPTTYRLLKDRPEFILIPRTREDLPLNFPANIPGVCYF
LQAHDQKTSAASRRCAT
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcgctaaactgaaggatctgaagattgcgggtgaatgcccgttttctatggtc
gtgggaaaggaggaacccgcggactttgaggaaagcgctgcggtgaatgctgtgccagta
tccagagaggtgcagggcaatctctccaacattctgcccagacgcaaaataagccggagc
aaagttaatctgcattcactgggcgagagcatccgaaagctggtgtgcccggagttcgac
aaattacgaaatgcattgatcagagttatgaaacagcagatagacatgagctgccctgca
gcatgcagttctgatgtatctcagatagtggacaatgctgaacaattatcagatgtcatg
agaaactactccctgaaaacagaaatccccatggatacgctaaagacttctctgggtctg
gaggtgtttcaggactgttatgaggaagacggtcatattcttcgtgtggtggggggagct
ctccacgattttctcaacagcttcaacgttctcctaaagcagagcacgccgcccaccccg
gaggttcagcgctacatccagcaagcctccatactctgcctggacaaggatccgggactc
ctgaccgtctatttcttcaatcccctccccaccaccgagctcttcttctcggggatcatc
caggcggcggcgtgctggctctactgcacacgggtggaggtcagaatggaggttgggggt
aaagacagcggtgctcttcaggccaatcatcagccccatctgctgtactcagtgtttgta
agagacggcaagagcctcacgccgagccccatgaggacacactcatctggagacattccc
ctctcgctgctctactccacttttcccttccacgttctcttggatcaggatatgggcctg
atgcagatcggagacggtttgaggaggaggctcggccgatgcagagacgggcaaaggacg
cccgttttcctcgagcactttgccattgtttcacctgagatacgagccagcttccaggat
attttaaccatgctaaacacccagtttgtgcttcgggtcaaacagcatggagcgagctct
gccgacagccctggaaagcacatggacctgaaggggcagatgatcttcatgtcagaaatg
agtgctctgctcttcctcggctctccgtgtgtagataagctggaggagttgacaggccgc
ggactctacctctctgacatccccatccacaatgcactacgagatgttgttctggtcggg
gagcagaccaaggcccaggatggactgaaaaagcgtctgagtaaagccaaagccgctctg
gaacaggcccaccaggccctggaagaagaaaagcggcgaacggtagagctgctcttcacg
atattcccagggaacgtcgctcagcgtttgtggcaggggcttccagtgccggcaaaaaag
tttgatcatgtcacggtgctgttctcagatatcgtgggcttcactgcgatctgctcgcga
tgcacgcccatgcaggtggtgaacatgctcagtgagctctacactcggtttgatcaccac
tgcggtgagctggatgtgtataaggtggaaaccattggcgatgcgtactgtgtagctgga
ggcttgcacaaagagagtccgactcatgctgaacagattgctctcatggctctgaagatg
atggacttgtctgatgaagtcacgactcccatgggagaggttatcaagatgcgtatcggg
atccactctggctcggttttgggcggcgttgtcggtgttaaaatgccccgctactgtctc
tttggcaataacgtcacattggccaacaagtttgagtcttgtagcctgccgagaaagatt
aacgtcagtcccaccacgtacagattgttaaaagatcgtccagagttcattctcatcccc
cggacgagagaggatcttccgcttaactttcccgccaacatccctggagtttgttacttt
ctccaggctcacgatcagaagacgagtgctgcttccagacgctgtgctacatga

DBGET integrated database retrieval system