KEGG   Sinocyclocheilus grahami: 107598937Help
Entry
107598937         CDS       T04918                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04218  Cellular senescence
sgh04350  TGF-beta signaling pathway
sgh04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107598937
   04350 TGF-beta signaling pathway
    107598937
   04068 FoxO signaling pathway
    107598937
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107598937
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107598937
   04218 Cellular senescence
    107598937
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107598937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107598937
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107598937
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107598937
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107598937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 107598937
NCBI-ProteinID: XP_016145866
Position
Unknown
AA seq 411 aa AA seqDB search
MNLYVLSLLLTLDLATVAVSLSTCSTLDMEQFKKKRIEAIRGQILSKLKLSSPPEIYPEP
EEVSRDIIAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPAENVISP
THYNPYFRRLRFDMSSMEKNASNLVKAELRIFRLQNSKARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTRTEGEWLSFDVTEAVSEWLLHRDRNNGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFVHGGDLKMFKKRRHSGQSPHLLLMLLPSYRLESQHKSHRQKRA
LDAAFCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSNI
LGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgtacgtcttgagtctccttctgaccttggatttagccacagtggccgtcagt
ttatccacatgcagcactctggacatggagcagttcaaaaagaagcggatcgaggccatc
cgcggtcagatcctcagtaaactcaagctgagcagtcctccggagatctaccccgagccc
gaggaggtgtcccgggacatcatcgccatctataacagcacacgggacctgctgcaggag
aaagccaacgagcgagcggccacctgcgagagacagcgcagcgaggaggagtactacgcc
aaagaagtgcacaagatagacatgcagcccttctaccctgccgagaatgtcatctctcca
acacattacaacccgtacttcaggaggctcaggtttgacatgagctccatggagaagaac
gcctcgaacctggtgaaggcagagctcaggatcttcaggctgcagaactcaaaggcccgt
gtgtctgagcagcggattgagctttaccagattttaggtcacaaggacctcacgtccccc
acgcaacgctacattgacagcaaggtggtgcgcacccgcacggagggcgagtggctgtcg
ttcgacgtgacggaggccgtcagcgagtggctgctgcacagagacagaaacaatggattc
aagatcagcctgcactgtccctgctgcacatttgtgccgtcaaataattacatcatcccc
aacaagagcgaggagctggaggcgcgctttgcaggtatagatgacagctttgtgcacgga
ggggatctgaagatgtttaaaaagcgccgtcacagcggtcagtctccacacctgctgctg
atgctgctcccgtcataccggctggagtcgcagcacaagagccacagacagaaacgtgct
ctggacgcggccttctgctccaggaatgtgcaggacaactgctgtttacgctctctctac
atcgacttcaagaaggatctgggctggaggtggatccacgaacccaaaggttataacgcc
aacttctgtgcgggagcctgtccatatctgtggagcgcagacacccagcacagcaacatc
cttggcctctataacaccatcaatccagaagcgtctgcatctccttgctgtgtgtctcag
gatctggaacccctcacaatcctttactacatcggaaaaacccccaaaatcgagcagctc
tccaacatgattgtcaagtcctgcaagtgcagctag

DBGET integrated database retrieval system