KEGG   Sinocyclocheilus grahami: 107598961Help
Entry
107598961         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 13-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04068  FoxO signaling pathway
sgh04218  Cellular senescence
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04370  VEGF signaling pathway
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04933  AGE-RAGE signaling pathway in diabetic complications
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107598961
   04370 VEGF signaling pathway
    107598961
   04068 FoxO signaling pathway
    107598961
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107598961
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107598961
   04621 NOD-like receptor signaling pathway
    107598961
   04622 RIG-I-like receptor signaling pathway
    107598961
   04625 C-type lectin receptor signaling pathway
    107598961
  09152 Endocrine system
   04912 GnRH signaling pathway
    107598961
   04914 Progesterone-mediated oocyte maturation
    107598961
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107598961
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107598961
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107598961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107598961
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107598961
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107598961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 107598961
NCBI-ProteinID: XP_016145887
Position
Unknown
AA seq 362 aa AA seqDB search
MESRVEFSREEINSTVWEVPDKYVCLKQIGTGAYGSVCSAINNKSKEKVAIKKLHRPFQS
EIFAKRAYRELRLLKHMKHENVIGLLDVFTPASRLDDFQDFYLVMPYMYTDLSKVKGILT
EDRIQFLVYQMLCGLKYIHGAGIIHRDLKPGNLAVNQDCELKILDFGLARHAEAEMTGYV
VTRWYRAPEVILNWMHYTQTVDIWSVGCIMGEMFNGKTLFKGKDYMDQLIQIMKVTGAPG
PEFTEKLESPEAKSYVKSLPHYPRKDFSTLFPRASEKAVDLLEKMLVLDADARLTADGAL
AHSYFDGLRDPEDCPEPTPYDDRYDNATLPLEEWKRLSFKEVRSFVPFPRRDSKRRNTLT
MS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagtcacgggtggaattcagtcgagaggagatcaacagtacggtatgggaagttccg
gacaagtacgtctgcttaaagcagatcggaacgggagcttatggcagcgtgtgctcggcc
attaataataaatccaaagagaaggtggctatcaagaagctgcaccgaccctttcagtca
gagatcttcgcgaagagagcctatcgtgaactgaggctgctcaagcatatgaaacatgaa
aatgtaataggcttgctagacgtcttcactcctgcctccagactggacgacttccaagac
ttctacctggtgatgccgtacatgtacacagacctctctaaagtcaagggcatccttaca
gaagaccgtatccagttcctggtctatcaaatgctgtgcggactaaagtacattcatggt
gctggcatcattcacagagacctcaaaccaggaaacctggctgtgaaccaagactgtgag
ctgaagatcctggattttggcctggcgcgccatgcagaagcagagatgacgggttacgtg
gtgacgaggtggtaccgggcccctgaggtcattctaaactggatgcactacacgcagaca
gtggatatctggtctgttgggtgcatcatgggtgaaatgttcaatggaaaaacactcttt
aaaggaaaagactacatggaccagttgattcagataatgaaagttacaggggcaccaggt
ccagaatttactgagaaactagaaagcccagaggcaaaaagctatgtcaaatccctgccc
cactacccacgcaaagacttctcaacattgtttcccagagccagtgaaaaagcggtagat
ctgcttgagaagatgctggtgttagatgctgatgctcgtctcactgctgatggtgcattg
gcacacagttattttgatggcctgagagacccagaggactgcccagagcccacgccgtac
gatgaccgctacgacaacgccacattgcccttagaagagtggaaacgtttatcgtttaaa
gaagtgaggagctttgttcctttcccaagaagagactcaaagagaagaaacacactcaca
atgtcctag

DBGET integrated database retrieval system