KEGG   Sinocyclocheilus grahami: 107599247
Entry
107599247         CDS       T04918                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107599247
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107599247
SSDB
Motif
Pfam: PAS HLH PAS_4
Other DBs
NCBI-GeneID: 107599247
NCBI-ProteinID: XP_016146270
Position
Unknown
AA seq 598 aa
MWILLFARNQKARFGEMIPPGDGLYAGKKRRKPVQKQKPEKAGQKSNPSKRHRDRLNAEL
DRLASLLPFSADVISKLDKLSVLRLSVSFLRVKNFFQAVQEKENRSSDTSTSEQKKEILP
RVIERDLLLKSLPGFALIVSSDGVIFYASCTIVDYLGFHQTDVMHQKVFDYIHVEERQEF
HRQLHWAMNPGQQDTVDEDAVMGHLYSSEEPDGVPPKLSPFLTRCFVARVRCLLDSTSAF
LNMQFQGSLKFLQGQKRKTDSGVLLPPQLALFCVAVPLVLPSIMELKMKSMMMKSKHNRS
GRSDKRQRVSHGSLDCEDMQCLNWTSTSGHDGSCSAMANRKYRGEGCKTQDEPLNFCVST
LGVSRLQAVDPSWDAHCPVALRTGPRENYLPGSFYKHSHSGKLRYGCNTELQKLESDCIN
RKAERRYTQNECFNVIPEAAIKTEDSDSENGCNAYGLLWWPEYAQVKTEAEYYDSFTSYQ
RGKAVISPPINGHLKYLCAGVSRPLKCVLNKDMNHSDAPISSQDGYVFSNDHKSCMQHDI
RLTCEFKSPNLVHTVKQEPDNSPPCCADVSQGNVQQRITSNCTMNTVLHKANPYVYMQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgtggattttgctgtttgccaggaaccaaaaggctcgttttggagaaatgattccgcct
ggagacggtctgtacgccggaaagaaaaggagaaaacctgtgcagaaacagaaaccagag
aaagcaggtcagaaatcgaatccatccaagcgtcatcgcgaccgtctgaatgcagaactg
gacaggttagcgagtctgctgcccttcagtgcagatgtcatctccaaactggacaaactc
tcagtgctgaggctcagcgtcagcttcctgcgggtgaagaacttctttcaagcagtccaa
gagaaagaaaatcgcagcagtgatacctcgacctcggagcagaagaaagaaatcctgccc
cgtgtcatagagagggatcttctcctaaagtcgctccctggatttgcactgatcgtgagc
tcggatggcgttattttctatgcatcatgcactatcgttgactacctgggatttcatcag
acggacgtgatgcatcagaaggtctttgattacatccatgtggaggagcgacaggagttt
cacaggcagctccattgggcgatgaaccctggccagcaagacactgttgatgaggatgct
gtgatgggtcatctatatagctctgaagagcctgacggcgttcctcctaaattgtctcca
ttcctcactcggtgcttcgtcgctcgagtccgctgcctgctggacagcacttctgccttt
ctgaacatgcagtttcagggcagcctgaagttcctgcagggtcagaagaggaagacagac
tctggagttctgctgccgcctcagctcgctctgttctgtgtggctgttcctctagtcctg
ccgtccatcatggagctcaagatgaagagtatgatgatgaagagcaaacacaataggtct
ggcagaagtgataagcggcagcgggtttcccatggctcgcttgactgtgaagacatgcag
tgtcttaactggacaagcacatccggtcatgatggttcgtgttcagccatggccaacagg
aagtacagaggagagggctgcaaaacccaagacgaacctctcaacttctgtgtttctact
ctgggcgtctctagattgcaggctgttgatccttcctgggacgcccactgtcctgttgcc
ttacgcacggggcccagagaaaactacctgcctggaagcttctataagcacagccattct
ggaaaattacgatacgggtgtaacacagaattgcagaagcttgagagtgattgcatcaac
aggaaggctgagagaaggtacacgcagaatgaatgttttaacgtgattcctgaagcggcc
attaagactgaagattcagactctgagaatgggtgtaatgcatacgggttgctttggtgg
cctgaatatgcacaggtgaaaaccgaggctgaatattatgactcttttacttcatatcaa
aggggcaaagctgtcatcagtcctcccatcaacggacacctcaagtatctgtgtgcagga
gtcagcagacctcttaagtgcgtcctgaacaaagacatgaatcactctgacgctcctatc
agcagtcaggacggatatgtgttttcaaatgatcataaaagctgcatgcagcatgatatc
cggctgacttgtgagttcaagagtcctaaccttgtgcacacagtcaaacaagaacctgac
aactctccaccttgctgtgctgatgttagtcaagggaatgtgcaacaacgtattacttca
aattgcactatgaacactgttctacacaaagcaaacccgtatgtttacatgcagtaa

DBGET integrated database retrieval system