KEGG   Sinocyclocheilus grahami: 107599530Help
Entry
107599530         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107599530
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107599530
   04261 Adrenergic signaling in cardiomyocytes
    107599530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107599530
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107599530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 DUF1673 DUF4064 DUF202
Motif
Other DBs
NCBI-GeneID: 107599530
NCBI-ProteinID: XP_016146640
Position
Unknown
AA seq 341 aa AA seqDB search
MSSFSTRALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQTTEVKMALHSGLWR
VCFVAGPEKGRCVASDYFTEPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFISGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFHYHYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEEMYRPHPALYRPRLSECSDYSGQYLHPDSWPPP
QRGRSGSEMSSDISIQLNQTPLPPPPKSSRPSNPPTSSGPSSGASYHLPPASSSSSSSYP
HTIHSSHSGGHAPQSLPMATPPYAVAPPRYHAHMRMSASPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagttcatttagcaccagggcgctgacgctcctgtcgtccgtgtttggggcttgtggg
ttactcctggtgggtgtggctgtgtcgacggactactggctgctaatggaagaaggcatt
gtcctgcagcagaaccagaccacagaggtgaagatggctctacattcgggactctggagg
gtctgttttgtagctgggccagagaaggggagatgtgtggcatctgactacttcaccgag
ccagaaatagagatcactaccgagaacacagccaatatacttaaaatggtcaggacggcc
acccccttccctatggtctcactcctctttgtcttcacggcctttgtcataagcaacatc
ggccacatccgtccccagcgcaccatcctggccttcatctctggaatcttcttcatcttg
tcaggtttgagtttagtggtcggtctggtgctgtatatctccagtataaatgatgaagtg
atgaacaggcctcgggagccggagcagttctttcactaccattacggctggtcgtttgcc
tttgctgccagctccttcctgctcaaagagggtgctggtgtcatgtctgtctatctcttc
atgaaacgttacgccgaagaagagatgtatcggccccaccctgcgctgtatcgccctcgc
ctgtctgaatgcagtgactacagtggccagtacctgcaccccgactcgtggcctcctcct
cagcgtggacgcagcggctccgagatgtccagcgacatctccattcagctcaaccagacc
ccgctgcctcctccgcccaaaagcagcaggccctccaatccacccacttcctcgggcccc
tcctccggggccagctatcacctcccacctgcttcctcctcctcctcctcttcctatcct
cacaccatccactcatctcattccggtggccacgcccctcagtccctcccaatggccaca
cccccatatgcagtcgcgccccctcgctaccatgcgcatatgcgtatgagcgcctccccg
tgttag

DBGET integrated database retrieval system