KEGG   Sinocyclocheilus grahami: 107599807Help
Entry
107599807         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107599807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107599807
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107599807
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107599807
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107599807
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107599807
   Centrosome duplication proteins
    Regulators of centriole replication
     107599807
  Sister chromatid separation proteins
   Polo kinases
    107599807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 107599807
NCBI-ProteinID: XP_016146978
Position
Unknown
AA seq 699 aa AA seqDB search
MVFPSRDAVRLEQRRAVLRYKSEETHRSSSTVTAHTVTHRAMETLTNTSYPTITTHNEQM
CELNKISEQGWKKPEDNSRTGTEYSRIITDPNTGKCYCRGKVLGKGGFAKCYEMTDLSSS
KVYAAKIIPHSRVSKPHQREKINREIDLHRALSHKHIVHFYHHFEDKDNIYILLEYCSRR
SLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDLKLGNLFVNDSMELKVGDFG
LAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWALGCVMYTMLLGKPPFETTNL
KETYRCIREARYTIPASLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFFTQGFMPETLPV
SCCHSAPDFHISSPAKSFFKKAAAALFGGKKDKAKYYENINRLAKEEEDIFKLRQDFRKT
AISNQITTHSSEEGGNPSAPTRKPVTQATAGRPQTRDTIHLIVRGSLGSCSSSSECLEDS
TTGTVAEAVISVLRGCLEHMPKADSLPRGNCCNSLKWVTKWVDYSNKYGFGYQLSDNTVG
VLFNNGTHMSLLSDKKTVHQYAALSQRSVFSVIEVPEYAVAQVTILKYFAHYMEENLMDG
GDMISEQDTQKTRIYLLQWLKSDRALLMLFNDGTFQVNFYHDHTKLILCTQQDEYLLTYI
NEERTSTTFQLSTLLSAGCTADLRRRLEYALNMLLQRCN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcccgtctcgtgacgcagttcgtctagagcagaggcgcgcggtgctgcggtat
aaaagcgaggagacacaccggtccagcagcactgtgacagcacacacagtaacacacaga
gccatggagacactgacaaatacctcttacccaactataacgacacacaacgaacagatg
tgtgagctcaataaaataagtgagcaaggatggaaaaagccagaggataacagtcggacc
ggaacagagtattccagaattattacagaccccaatactgggaaatgttactgccgggga
aaagttctaggaaagggaggctttgcaaagtgctatgaaatgaccgacctatcttcaagt
aaagtctatgcagccaaaatcatcccgcattcacgtgtgtcaaaaccgcaccagagagag
aagataaaccgagagattgacctgcacagagctctcagccacaaacacatagtgcatttc
taccaccactttgaagacaaagacaacatctatattctgttggagtactgcagtagaaga
tcactggcccatatactgaaggcacgtaaagtcctaacagaacctgaagtgaggtattac
ttgaaacagacagtgtctgctttaaaataccttcacgatttagagatcctgcatcgtgat
ttgaaacttggcaacctgtttgtgaatgactcaatggagctgaaagtgggagattttggg
ctggctgccaaactggagccagtcagcaacagacgcaaaacgatctgtggtacacccaac
tacctgtccccggaagtgctgaacaaacagggccacggctgggagtctgacgtgtgggct
ttgggctgcgtcatgtacaccatgcttctgggtaaacctccattcgagaccactaacctg
aaggagacataccgctgtatccgagaggcccgttacaccatcccggcctcgctctctctc
cccgctaaacagctcatttctggcatgctcgcacagaaccctgtggaccgcccgcacctg
gatgacatcattcggcatgaatttttcacccagggcttcatgccagaaactctgcctgtc
agctgctgccattctgccccagacttccacatttccagtccagccaagagcttcttcaaa
aaggcagctgctgctctcttcggtggcaagaaggacaaagccaagtactatgaaaatata
aatcgcttagccaaagaagaggaagacatattcaagctccgtcaagatttcagaaagact
gccatcagtaatcagattactacacactcatctgaggaaggaggaaatccgtcagcacct
acaagaaagcctgttacccaggcaactgccggaaggccgcagacaagagataccattcac
ttgattgttagaggcagcttgggcagctgcagcagcagcagtgaatgtcttgaagacagc
accactggcactgtggcagaggctgttattagtgttctgagaggctgtcttgaacacatg
cctaaagcggacagccttcccagaggaaattgttgtaatagcttgaagtgggtgactaag
tgggttgactactccaacaaatatggttttggctatcagctgtctgacaatacagtgggc
gtccttttcaacaacggaacgcacatgagtctcctctctgacaagaagactgttcatcag
tatgctgcccttagccagaggtctgttttctctgttattgaggttcctgagtatgctgtg
gcccaggtcaccatcctcaagtactttgcccactacatggaggagaatttgatggatgga
ggggatatgataagtgaacaagatacccagaagaccagaatatatcttctgcagtggctg
aaatcagacagagctttattgatgcttttcaacgatggcacattccaggtgaacttctac
cacgaccacaccaagctcatcctgtgcacacagcaggacgaatatctgctgacgtacatc
aacgaagagcgaacctccaccaccttccaactgagcacgctgctcagcgcgggctgcact
gcggacctgcggagacgtctggagtatgccttgaacatgctgctgcagagatgcaactga

DBGET integrated database retrieval system