KEGG   Sinocyclocheilus grahami: 107600215
Entry
107600215         CDS       T04918                                 

Definition
(RefSeq) uncharacterized protein LOC107600215
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107600215
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107600215
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 107600215
NCBI-ProteinID: XP_016147538
Position
Unknown
AA seq 565 aa
MIPPGDCLYAGRKRRKPVQKRKPEKAGQKSNPSKRHRDRLNAELDRLASLLPFSADVISK
LDKLSVLRLSVSFLRVKSFFQAVQEKENHSSDALTSAHKKEILPHVIESDLLLKSLPGFA
LIVSSDGVIFYASSTIVDYLGFHQTDVMHQKVFDYIHVEERQEFHRQLHWAMNPGQQDTD
EDVVMGHLYIAEVPDGVPPELSPFLTRCFVARVRCLLDSTSGFLNMQFQGSLKFLQGQRR
KTDSGVLLPPQLALFCVAVPLVLPSIMELKMKSMMMKSKHKSDERQRVSHGSFDSEDMLH
LNWTSSSGHDSSCSSLTNRKYRGEGCKTQDEPLNFCVSRLQAVDPSWDARCPVALRTGPN
ESNLPGSIYKHSHSGKSRIGCNTELQKLESYCVNRKAERRYVQNECFNMIPEVAIKTEAS
DSENGCKVYGTLWHPEYAQVKTEAEYYDYCASYQRGKAVISPPINGQHKYLCAGVSRPLK
CVLNKDMNHSDAPISSQDGYAFSNDHKSCMQHDIRLTCEFRSHNLLHSIKREPLDVSQGH
VQQHITSNCTMNTVLHKANPYVYMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgattccacctggagactgtctgtatgctggaaggaaaaggagaaaacctgtgcagaaa
cggaaaccagagaaagcaggtcagaaatcgaatccgtccaagcgtcatcgcgaccgtctg
aatgcagaactggaccggttggcgagtctgctgcccttcagtgcagatgtcatctccaaa
ctggacaaactctcagtgctgaggctcagtgtcagcttcctgcgggttaagagcttcttt
caagcggtccaagagaaagaaaatcacagcagtgatgccttgacctcggcgcacaagaaa
gaaatcctgccccatgtcatagagagtgatttactcctaaagtctctgcctggatttgcg
ctgattgtgagctcggatggtgttattttctatgcatcatccaccatcgttgactacctg
ggatttcatcagacggacgtgatgcatcaaaaggtctttgattatatccatgtggaagag
cgacaggagtttcacaggcagctccactgggcgatgaaccctggccaacaagacactgat
gaagatgttgtgatgggtcatctgtatatcgctgaagtgcctgacggtgttcctcctgaa
ctgtctccatttctcacacggtgcttcgtcgctcgagtccgctgcctgctggacagtacc
tccggcttcctgaacatgcagtttcagggcagtctgaagttcctgcagggtcagcggagg
aagactgactctggagttctgctgccgcctcagctcgctctgttctgtgtggctgttcct
ctagtcctgccctccatcatggagctcaagatgaagagtatgatgatgaagagcaaacac
aaaagtgatgaaaggcaacgagtttcccatggctcgtttgacagtgaagacatgctacat
cttaactggacaagctcatccggtcatgacagttcgtgctcatccctgaccaacaggaag
tacagaggagagggctgcaaaacccaagacgagccgctcaacttctgtgtttctagactg
caagctgttgatccttcctgggatgcccgctgtcctgttgccttacgtacggggcccaat
gaaagcaacctgcctggaagcatctataagcacagccattctggaaaatcacgaattgga
tgcaacacagaattgcagaagcttgagagttattgtgtcaacaggaaggctgagagaagg
tacgtgcagaatgaatgttttaacatgattcctgaagtggccattaagacagaagcttca
gactctgagaacgggtgtaaggtatacgggacgctttggcaccctgaatatgcacaggtg
aaaaccgaggctgaatattatgactattgtgcctcatatcaaagaggaaaagctgtcatc
agtcctcccatcaacggacaacacaagtatctgtgtgcaggagtcagcagacctcttaag
tgtgtcctgaacaaagacatgaatcactctgacgctcctatcagcagtcaggacggatat
gcattttcaaatgatcataaaagctgcatgcagcatgatatccggctgacttgtgagttc
aggagtcacaaccttctgcactcgatcaaacgagaacctctggatgttagtcaagggcat
gtgcaacaacatattacttcaaattgcactatgaacactgttctacacaaagcaaaccca
tatgtttacatgcagtaa

DBGET integrated database retrieval system