KEGG   Sinocyclocheilus grahami: 107600594Help
Entry
107600594         CDS       T04918                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04020  Calcium signaling pathway
sgh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107600594
   04020 Calcium signaling pathway
    107600594
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107600594
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107600594
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107600594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TetR_C_27
Motif
Other DBs
NCBI-GeneID: 107600594
NCBI-ProteinID: XP_016148013
Position
Unknown
AA seq 394 aa AA seqDB search
MLKVTMPASRAAAEYWIDGSKKETLADFYELESELGRGATSVVFRCHQKGTQKHYAVKML
KKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYS
ERDAADAVKQVLEAVACVLHHTGSHFIKDGGCQGDSKKVGKFLMGWIQLVGCNKRTPTLQ
LPPGHKTRAEERKRKRSDFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSV
GVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKK
RLSTQQALQHPWVSGKAVNFTHMDTAQKKLLEFNARRKLKAAVKAVVASTRLGSAGSHGN
PDGNKPDSSPSSIKEKTAEDQPDTEQPQIQNEGS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtgacaatgcccgcctctagagccgctgctgaatactggatcgacggatcc
aagaaagagacgctggcggacttctatgagctggagtctgaattgggacggggagccaca
tcagtggtgttcagatgccatcagaaaggcacccagaagcactatgctgtgaaaatgcta
aaaaaaacagttgacaagaagattgtacgaacggagataggtgtattactgcgcctctct
catccaaatataatcaaactaaaggagatctttgagacccctgcggagattagtctcgtg
ttagaacttgttaccggcggagaattatttgacagggtggtggagaagggctactacagc
gaacgagacgccgctgatgcagttaaacaagtgctggaggcagtcgcgtgtgttctccac
cacactggctctcacttcatcaaagatggcggttgccaaggagatagtaagaaagtgggc
aaatttctcatgggctggattcagttggtgggctgcaataagagaacgccaactctccag
ctcccaccagggcataaaacaagagcagaggaacggaaacggaaacgctcggattttggt
ttgtcgaaaattgtagacgatcaggtaacaatgaagactgtgtgtgggactccaggctat
tgtgctcctgagattttgcggggatgtgcctatggccctgaggttgacatgtggtctgtg
ggagttatcacgtacattttgttatgtggttttgagcccttttttgatgacagaggagac
cagtacatgtttaaacgcatcctgaactgtgaatatgaatttgtctccccctggtgggac
aatgtgtctctcaatgccaaggaccttgtgaagaaactgattgtccaggatccaaagaaa
cggctgtcgacacagcaggcactgcagcacccctgggtctctggaaaggctgttaacttc
actcatatggacacggctcagaagaaactcctggagttcaatgctcgaagaaaactcaag
gcagcggtcaaagcggtggttgcttcaactcgattgggcagcgcaggaagccatggcaac
ccagacggcaacaaacccgacagcagtccctcctctatcaaagagaagacagcagaggat
cagccagacactgaacagcctcagattcagaatgaaggctcttag

DBGET integrated database retrieval system