KEGG   Sinocyclocheilus grahami: 107602235
Entry
107602235         CDS       T04918                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107602235
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107602235
Peptidases and inhibitors [BR:sgh01002]
 Metallo peptidases
  Family M1
   107602235
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N ERAP1_C
Other DBs
NCBI-GeneID: 107602235
NCBI-ProteinID: XP_016150169
Position
Unknown
AA seq 824 aa
MSWCLCCTTFAVLFCGLFVGSHAMTVNTDTNALPFPWDKIRLPETVKPQHYDLLVHPNLT
SLTFTGVVQILIELEQDTRAIILHSKNLQISKAQLLGPRHPQHLQISESEAYEQIALFSD
GFTFERGNHVVHLEFYANLSDSFHGFYKGRYTTNSGEVRMMASTQFEPTHARAAFPCFDE
PAFKANFTIRVRRESRHISISNMPKLRTVEMADGLLEDQFDTTVKMSTYLVAFIISDLQS
ISKKSQHGVEISVYTVPEKISQAEYALNTAVTLLDFYDDYFDIPYPLPKHDLAAIPDFQS
GAMENWGLSTYRESGLLFDPEKSSSSDKLGITKVIAHELAHQWFGNLVTMQWWNDLWLNE
GFAKFMEYVSVSITHPELQVDDYFLEKCFTAMSVDSLTSSHPVSTPVENPAEISEMFDDV
SYRKGACILNMLRDFLTPEAFKYGIIHYLKTHSYQNTVNAHLWESLTNICTSDELDSGRL
KLDGFCSKSRAESPASQKWFMEDSVDVQAIMDTWTLQEGFPLITVEVKGQEVTLKQERFL
REANSSNTSSFLWQVPLTYITSHSSAVQRFLLKSEKDVLYLPEKVDWIKFNVDLRGYYIV
HYKSGGWDALINQLQQNHSVFSSNDRASLIHDIFQLVSIEKIPLDKALNLSLYLSKESEI
MPVTQGFNELVPLYKLMEKRNMEALENQLKGHLVKLFKTLIDRQSWSDGGSVSERMLRNY
LLLFACVRRYPSCISTATRLFQQWKESDGKMWLPTDVSLVVYTEGARTDEGWDFLLEKYK
RSVSPSEKWMIKAALSYSPLAHKLQWLLERSIEGEKVINSPGTS
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgtcttggtgtttatgctgcactacatttgcagttttattctgtggtctttttgttggc
agccatgcaatgactgtcaacaccgacacaaatgccttgccttttccctgggataagata
agattgccagaaacagtgaaaccccagcactatgacctcctggtgcaccccaacttgacc
tccctgaccttcaccggagtggtccagattctcatagagctagagcaggacaccagagcc
atcatccttcacagcaagaacctgcagatctccaaagctcagctcttgggccccagacat
cctcagcatctgcaaatcagtgagtctgaagcctatgaacagatcgcactcttttctgat
ggcttcacatttgagagaggaaaccacgtggtgcatttggagttctacgccaacttatca
gacagttttcacggcttttataaaggcagatataccacaaacagcggagaggtcaggatg
atggcatccactcagtttgagccgacgcatgctcgagctgccttcccttgttttgatgaa
cctgcatttaaagccaactttaccatccgtgtgcgccgagaatccaggcatatttccata
tccaacatgcccaagctgagaactgtagaaatggctgacgggctgctcgaggatcagttt
gacacgacggtgaagatgagcacctacctggtggccttcatcatctccgatttacagtcc
atcagtaaaaaaagccagcatggagtcgagatatcagtgtatactgttcccgagaagatc
agtcaggcggaatatgctctcaacaccgccgtcacactgctggacttttatgatgattat
tttgacatcccatatccacttcccaaacacgatcttgcagcaatcccagatttccagtca
ggtgctatggagaattggggcctgtcgacttacagagagtccggtttgctctttgaccct
gagaaatcttcttcctcggacaaactgggaatcaccaaagtcattgcccatgaactagcc
catcagtggtttggaaacctggtcacgatgcagtggtggaacgacctgtggttaaacgag
ggctttgccaagttcatggagtatgtgtccgtcagcatcacccaccctgagctgcaagtg
gatgattatttcctggagaagtgcttcactgctatgtcagtggactctttaacctcctca
caccccgtttccactccagtggagaatcctgcggagatcagcgagatgttcgatgacgtt
tcctaccggaagggtgcgtgtatcctgaacatgctgagggatttcctgacgccagaggct
ttcaagtacggtattatacactacctgaagacacacagctaccagaacacagtgaacgct
cacctctgggaaagtcttaccaatatctgcacttctgatgaattggattcagggagacta
aaactcgatggattctgttccaaaagcagggctgaatctccagcctctcagaaatggttc
atggaggacagtgttgatgttcaagccattatggacacctggacgctgcaggagggcttt
cctttaatcactgtggaggtcaaaggtcaagaggtcaccctcaaacaggagcgcttcctt
agagaagcaaactcttcaaatacatcaagcttcttgtggcaggttcctctgacttacatc
accagtcacagtagtgcagtgcagcgtttcttgctgaaaagtgaaaaagatgtgttgtac
ctgccagagaaggtggactggattaaatttaatgtggacctgcgggggtattatattgta
cattataagtcaggaggctgggacgctttgatcaaccaactccagcaaaaccacagtgtg
ttcagcagcaacgacagagccagtctgatccacgacatctttcagctggtcagcattgag
aaaatcccactggacaaagctctgaatctgagtttgtacctcagtaaagagtcggagatc
atgccggtgacgcagggctttaatgagctggtgccgctttacaaactcatggagaagaga
aacatggaggcactggagaaccagctgaagggtcatttagtgaagttattcaagacgctg
attgaccgccagagctggtctgatggtgggtctgtgtccgagcggatgctcaggaactat
ctgctgttgttcgcctgcgtccgccgttacccatcctgcatcagcaccgccactcgactc
ttccagcagtggaaggaatccgatggcaaaatgtggctgcccactgacgtcagtttggtg
gtctacactgaaggggcgcgtacagacgaaggctgggacttcctgttggagaaatacaag
cgatccgtctcgccatcggagaagtggatgattaaagccgcactctcgtacagtccatta
gctcacaagcttcagtggcttttggaaagaagcattgaaggagagaaggtcatcaactcg
cctgggacttcttga

DBGET integrated database retrieval system