KEGG   Sinocyclocheilus grahami: 107602566Help
Entry
107602566         CDS       T04918                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107602566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107602566
Ion channels [BR:sgh04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107602566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan-Glu_bd Lig_chan SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 107602566
NCBI-ProteinID: XP_016150580
Position
Unknown
AA seq 627 aa AA seqDB search
MQRSLTLLCTSFLGLCLGSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQVDM
VKMGNSFSMTYAFCSQFSKGVYAIIGVYDRKTVNMLMSFCGALHVCFVTPSFPMENSNQF
VIQLRPELQDALVAVIEHYKWSRFVYMYSSDSGLSVLQKVLDTAAEHNWLVTSVNVETMT
EASFLKVFQDLDKKKEGQIIIDCELERLTSILKKIIELGKNVKSYHYILANLGFLDIDLT
EFKKSEANVTGFQLVNYADRNISRIVQQWMDFDNKDAKVPKRGLKYTGALTYDGVKVMST
AFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIEGLTGHIQFNEKGRRT
NYTVSVMELRPTGPKKVGYWNEDEKFVSTAAYMPGSNDTYGLQNRTYIVTTILESPYVML
KKNHEQFTGNDKYEGYCVELAAEIAKHVGYHYILKIVADGKYGARDPETMMWNGMVGELV
YGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWHAEDCEEGAEQNPNQPSSSSAQPGQGQQNQNQQSQEQ
TNEFGIFNSLWFSLGAFMQQGCDISPR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcctcacactgctctgcaccagttttctgggattgtgcctcggttccagt
ttcccaagtaatatcaacataggagggttattcccaaccgaatcacacgaatatgaagtg
tttcggtttgcgctctcgcatcaccaggatatccctaaactggtacctcaagtggatatg
gtcaaaatggggaatagcttctccatgacatatgctttctgttcgcagttctccaaagga
gtgtacgccatcatcggcgtgtacgacaggaagactgtcaacatgttgatgtcgttctgc
ggtgcgctacacgtctgcttcgtgacgcccagcttccccatggaaaactccaaccagttt
gtcatccagctgagacccgaactgcaggacgccctggtggccgtaatcgagcactacaag
tggtctaggttcgtctacatgtacagctcggactctggactgtcagttctgcagaaggtt
ctggacacagcagcggagcataactggctggtgacctccgtgaatgttgagacaatgaca
gaagcgtccttcctcaaagtgttccaggacctggacaaaaagaaggagggccagatcatc
atcgactgtgagctggagagactcacctccatcctgaagaagatcatcgagttggggaaa
aatgtgaagagctaccactacatactagcaaacctggggtttctggacatcgacctgaca
gagtttaagaagagtgaagcgaatgtaacaggcttccagctggtgaactatgcagaccgt
aacatcagtagaatagtgcagcagtggatggactttgacaataaagacgccaaagttccc
aagcgaggactgaagtacactggagctctcacatatgatggagtcaaagttatgtccaca
gccttccagaacctccgtaggcagaggatagatatatctcgccgtggaaatgctggagaa
tgtctggccaacccaccagcaccttggggacaaggcatcgatattcagagagcacttcag
caggttcggattgaaggcctaacgggacacattcagtttaacgaaaaaggacgaaggaca
aactacactgtcagtgtgatggagctcaggccgacaggaccaaaaaaagtgggttactgg
aatgaggatgagaaatttgtgagcacggcggcctacatgccaggcagtaatgacacttac
ggacttcagaatcgcacatatattgttaccactattctggaatcaccgtatgtcatgctg
aaaaagaaccacgagcagtttactggaaatgataagtatgaaggttactgtgtggaactg
gcagctgagatagccaaacacgtgggataccactacatactcaagatagtggctgatggg
aaatatggagccagagatcctgagaccatgatgtggaatgggatggtgggagagctcgtc
tatggtaaagctgacgtagctgtagccccactaaccatcaccctggtcagggaggaagtc
attgatttctccaagcccttcatgagcctcggcatctccatcatgatcaaaaagcccacc
aagtccaagcctggtgtgttctccttcctggaccctttggcctatgagatctggatgtgt
attgtgttcgcctacatcggcgtgagcgtggtgcttttcctagtcagccgcttcagtccc
tacgagtggcacgcagaggactgcgaggaaggagcagagcagaaccctaaccaaccctcc
tcgtcatccgctcaaccgggacagggccagcagaaccagaaccagcagagtcaggagcag
accaacgagtttggtatcttcaacagtctctggttctcattgggtgctttcatgcagcaa
ggctgtgatatttcccccaggtaa

DBGET integrated database retrieval system