KEGG   Sphingopyxis granuli: SGRAN_1422Help
Entry
SGRAN_1422        CDS       T04372                                 

Gene name
mhpE2
Definition
(GenBank) 4-hydroxy-2-keto-pentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00360  Phenylalanine metabolism
sgi00362  Benzoate degradation
sgi00621  Dioxin degradation
sgi00622  Xylene degradation
sgi01100  Metabolic pathways
sgi01120  Microbial metabolism in diverse environments
sgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SGRAN_1422 (mhpE2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGRAN_1422 (mhpE2)
   00622 Xylene degradation
    SGRAN_1422 (mhpE2)
   00621 Dioxin degradation
    SGRAN_1422 (mhpE2)
Enzymes [BR:sgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     SGRAN_1422 (mhpE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AMG73811
UniProt: A0A0X8R227
Position
1541959..1542996
Genome map
AA seq 345 aa AA seqDB search
MSFDPTTTKLYIQDVTLRDGMHAIRHQYGLDHVRAIARALDAAKIDAIEVSHGDGLQGSS
FNYGFGAHTDWDWIGAVAEVLEHSVLTTLLLPGIGTIHDLKHAYEMGVRSVRIATHCTEA
DVAKQHIEFARGIGMDVAGFLMMSHMSEPEALAGQAKLMESYGAHCVYVTDSGGALTMDG
YAARLAAYDRVLKPETQRGVHAHHNLSLGVANSIVAVQNGAIRVDASLAGMGAGAGNAPL
EVFIAAADVYGWNHGCDLFALMDAAEELVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAE
KVAADHGLDTRAILVELGRRKMVGGQEDMIVDVALDMVRRRDVAG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgaccccaccaccaccaagctctatatccaggacgtgacgctgcgcgacggg
atgcatgcgatccgccaccaatacggcctcgaccatgtgcgcgcgatcgcgcgggcgctc
gacgctgcgaagatcgacgcgatcgaggtgtcgcacggcgatggcctgcaaggatcgagc
ttcaactacggcttcggcgcgcataccgactgggactggatcggcgcagtggccgaggtg
ctggagcatagcgtgctcacgaccttgcttctccctggcatcgggacgattcacgatctg
aagcacgcctatgaaatgggcgtgcgatcggtccgcattgcgacgcattgcaccgaggcc
gacgtcgcaaagcagcatatcgagttcgcgcgcggcatcggtatggacgtcgcgggcttt
ctgatgatgagccatatgtccgagcccgaagcgctcgcgggccaggcgaagctgatggaa
agctatggcgcgcattgcgtctatgtcaccgattcgggcggtgcgctgacgatggacggc
tatgcggcacggctcgccgcctatgatcgcgtgctgaagcccgagacgcagcgcggcgtc
cacgcgcaccacaatctcagcctcggcgtcgcgaacagcatcgttgcggtgcagaacggt
gcgatccgcgtcgacgccagccttgccggcatgggcgcgggggcgggcaatgcgccgctg
gaggtcttcatcgccgccgccgacgtctatggctggaaccatggctgcgacctgttcgcg
ctgatggatgccgccgaggaactggtgcgcccgctgcaggaccgcccggtgcgcgtcgat
cgcgagacgctgaccctcggctatgccggggtctattcctcttttctgcgccatgccgaa
aaggtcgccgccgaccacggactcgacacgcgcgcgatcctcgtcgaactcggccgccgc
aagatggtcggcggtcaggaggacatgatcgtcgacgtcgcgctcgacatggtgcgccgc
cgcgatgtcgcgggctga

DBGET integrated database retrieval system