KEGG   Sphingopyxis granuli: SGRAN_2099Help
Entry
SGRAN_2099        CDS       T04372                                 

Gene name
maiA
Definition
(GenBank) Maleylacetoacetate isomerase MaiA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00350  Tyrosine metabolism
sgi00643  Styrene degradation
sgi01100  Metabolic pathways
sgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SGRAN_2099 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SGRAN_2099 (maiA)
Enzymes [BR:sgi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     SGRAN_2099 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AMG74474
UniProt: A0A0X8R3E2
Position
2290774..2291406
Genome map
AA seq 210 aa AA seqDB search
MTSLVLHDYFRSSASYRVRIALNLKRLAYERVEISLIAGEQKSDSYLAQNAQGFVPLLVA
DGQTIIQSLAIIDWLDRAFPEPRLIPDAAMPRAVALAQAQVVACDIHPLNNLRVLKYLKR
DLGLNEQTKDRWYRHWIIEGFDALEAMAGDGRYLGGETPGIADCCLVPQMYNARRFEVPL
DAYPRLVAIDAACTGLDAFQRAHPDAVKAA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgctcgtcctccacgattatttccgctcctcggccagctatcgcgtccgcatc
gcgctgaatctgaagagactcgcctatgagcgcgtcgagatcagcctgatcgcgggcgag
cagaagagcgactcctatctcgcgcagaatgcgcagggcttcgtgccgctgctcgtcgcc
gacgggcagacgatcatccagagcctcgcgatcatcgactggctcgaccgcgcctttccc
gaaccgcggctgatccccgatgccgcgatgccgcgcgcggtcgcgctcgcgcaggcacag
gtcgtcgcctgcgatatccacccgctcaacaatctgcgcgtgctcaaatatctgaagcgt
gacctcgggctcaacgagcagaccaaggaccgctggtatcgccactggatcatcgagggc
ttcgacgcgctcgaggcgatggcgggcgacggccgctatctcggcggcgagacgcccgga
atcgccgactgctgcctggtgccgcagatgtacaatgcgcggcggttcgaggtgccgctc
gatgcctatccgcggctcgtcgccatcgacgcggcgtgcacagggctggacgcgttccag
cgggcgcatcccgacgcggtgaaagcggcatga

DBGET integrated database retrieval system