KEGG   Sphingopyxis granuli: SGRAN_2792Help
Entry
SGRAN_2792        CDS       T04372                                 

Gene name
thnI
Definition
(GenBank) Acetyl-CoA acteyl transferase-like protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00071  Fatty acid degradation
sgi00072  Synthesis and degradation of ketone bodies
sgi00280  Valine, leucine and isoleucine degradation
sgi00310  Lysine degradation
sgi00362  Benzoate degradation
sgi00380  Tryptophan metabolism
sgi00620  Pyruvate metabolism
sgi00630  Glyoxylate and dicarboxylate metabolism
sgi00640  Propanoate metabolism
sgi00650  Butanoate metabolism
sgi00900  Terpenoid backbone biosynthesis
sgi01100  Metabolic pathways
sgi01110  Biosynthesis of secondary metabolites
sgi01120  Microbial metabolism in diverse environments
sgi01130  Biosynthesis of antibiotics
sgi01200  Carbon metabolism
sgi01212  Fatty acid metabolism
sgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGRAN_2792 (thnI)
   00630 Glyoxylate and dicarboxylate metabolism
    SGRAN_2792 (thnI)
   00640 Propanoate metabolism
    SGRAN_2792 (thnI)
   00650 Butanoate metabolism
    SGRAN_2792 (thnI)
  Lipid metabolism
   00071 Fatty acid degradation
    SGRAN_2792 (thnI)
   00072 Synthesis and degradation of ketone bodies
    SGRAN_2792 (thnI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGRAN_2792 (thnI)
   00310 Lysine degradation
    SGRAN_2792 (thnI)
   00380 Tryptophan metabolism
    SGRAN_2792 (thnI)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SGRAN_2792 (thnI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGRAN_2792 (thnI)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SGRAN_2792 (thnI)
Enzymes [BR:sgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SGRAN_2792 (thnI)
Exosome [BR:sgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SGRAN_2792 (thnI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMG75141
UniProt: A0A120LUI2
Position
complement(3034480..3035688)
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYDGIRSPIGRYGGKLASVRPDDLAAKVVRELVARSSFDGAQVEDVIMGNVTQSG
EDSRNVARHIALAAGLPVEAAGQTVNRLCGSGLAAVLDAARTVRCGEGELFVAGGVESMS
RAPFVMGKAESAYSRAAKIYDTTIGSRFPNPAITDPYGNDSMPETADNVARELDLTREDG
DLFACNSQAKYARAKAAGFYDEEILPIEVSTGRKTPPVAVADDEHPRADTELAKLTSLRP
LFEGGVVTAGNASGINDGAAALLIGSTAIGERAGARPLARIVAGAVAGVPPRIMGLGPVP
ATRKVLERAGIRLADLDVIEINEAFAVQVLGCCQQLGLAGDDERLNPNGGGIALGHPLGC
SGARLALTATRQLHRVGGRYALVTMCIGVGQGIAAIIERVEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcatatatctacgacggtattcgttcgccaatcgggcggtatggtggcaag
ctggcatctgtccgtccggacgatctcgcggccaaggtggttcgagagctcgtggcgcgt
tcgtcgttcgatggcgcgcaggtcgaagatgtcatcatgggcaatgtcacccagtcgggt
gaggacagccgcaatgtggcgcggcatatcgcccttgctgcaggtctgccggtggaggcc
gcgggccagacggtcaaccggctgtgcggatcggggcttgcggcggtgctggatgccgcg
cggaccgtgcgttgcggtgagggtgagctgttcgtggccggcggcgttgagagcatgtcg
cgcgcgcccttcgtgatgggaaaggcggaaagtgcctacagccgtgccgcgaagatctac
gataccactatcggcagccggttccccaacccggcgatcaccgacccctatggcaatgat
tccatgccggaaacggctgacaatgttgcgcgtgaactggacctcacgcgcgaagacggc
gatctgttcgcctgtaattcgcaagcgaaatacgcgcgggcgaaggcggctggcttttac
gatgaagagatcctgccgatcgaggtttcgaccgggcgcaagacaccgccggtcgctgtt
gctgacgatgagcacccgcgagccgataccgaactggcgaagctcacgagcctgcgaccg
ctgttcgagggcggcgtggtcactgccgggaacgccagcgggattaatgacggtgctgcg
gctctgctgatcggttcgacggcgatcggcgagcgcgccggggcgaggccgcttgcccgg
atcgtcgcgggggcggtggcgggtgtgccgccgcgcatcatggggctgggaccggtgccg
gccacgcgcaaggttctggagcgggccgggatcaggcttgccgatcttgacgtcattgaa
atcaacgaggctttcgcagtgcaggttctcggctgctgccagcagctcggtctggccggt
gatgacgaacgtctcaaccccaatggcggcggtattgccttgggccatccgcttggatgc
tcgggcgctcgcctggctctgaccgcaacgcgccagctgcaccgggtcggggggcgctat
gccctggtcacgatgtgtatcggcgtcggtcaggggatcgcggcgatcattgagcgcgtc
gaggcgtaa

DBGET integrated database retrieval system