KEGG   Sphingopyxis granuli: SGRAN_3277Help
Entry
SGRAN_3277        CDS       T04372                                 

Definition
(GenBank) Butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SGRAN_3277
Enzymes [BR:sgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SGRAN_3277
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SGRAN_3277
    1.1.1.-  
     SGRAN_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AMG75620
UniProt: A0A109YMT2
Position
3592063..3593142
Genome map
AA seq 359 aa AA seqDB search
MRAVVSHGKKDFRIESRADPRPGTGEVLVRPLFNGLCFTDKHLFDGHVERAADIVIGHEF
SAEIVALGDRVDDWRPGDHVSVDPRIRCGTCLACRAGLETLCPDGGFLGVRGADGGLADL
CVAPAYGLYRLPEAVSPLQAACVEAACCATRALRSGAIVPGDNVVLLGLDDYNLFVAQWL
KAQGGLVIGVDGASVRREAARGFGAATCLDPSSDNIVRAVRAAMPFGADVVVVALEDYAP
AATDYLALAHRLARIQGTVILIRAYGAEPFARIQPSTAWLKELTIRHFGNFFGNEPARGG
RDRGDWQVTLDAIGRGILAAPPPQTELVPFSALKTAGDIGALFDGLPGSAAKIVVDMAD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtcgtaagccacggcaaaaaagacttccggatcgagagccgcgccgatccg
cgccccggcacgggcgaggtgctggtgcggccgctgttcaatggcctctgtttcaccgac
aagcatctcttcgacggccatgtcgagcgtgccgccgacatcgtcatcggccatgagttc
agcgccgagatcgtggcgctcggcgatagggtcgacgactggaggccgggcgaccacgtc
tcggtcgacccgcgcatccgctgcgggacctgcctcgcctgccgcgccggtctcgagacg
ctctgtcccgatggcggcttccttggggttcgcggcgccgacggcggcctggccgatctc
tgcgtcgcacccgcttatggtctctaccgactgccggaggccgtctcgccgctccaggct
gcctgcgtcgaggccgcctgctgcgcgacgcgcgcgctgcgctcgggcgcgatcgtgccg
ggtgacaatgtcgtcctgctcggtctcgacgactataatctcttcgtggcgcagtggctg
aaagcccagggcgggctcgtgatcggcgtcgacggcgcgtcggtccgccgcgaggcggcg
cgcggtttcggcgccgccacctgcctcgatccttccagcgataatatcgtccgcgcggtg
cgcgccgcgatgccgttcggcgccgatgtcgtcgtcgtggcgctcgaggattatgcaccc
gcggccaccgactatctggcgctggcgcaccgtctcgcgcgcatccagggtaccgtgatc
ctgatccgcgcctatggcgccgagcccttcgcgcgcatccagccttcgactgcctggctc
aaggagctgacgatccgccacttcggcaatttcttcggcaatgagcccgcgcgcggcggg
cgcgatcgcggcgactggcaggtgacgctcgacgcgatcggccgcggcatcctcgccgcg
ccgccgccgcagaccgagctggtccccttcagcgccctcaagaccgccggcgatatcggc
gcgctgttcgacgggcttcccggatcggcggcgaagatcgtcgtcgatatggcggactag

DBGET integrated database retrieval system