KEGG   Sphingopyxis granuli: SGRAN_3519Help
Entry
SGRAN_3519        CDS       T04372                                 

Definition
(GenBank) Molecular chaperone GroES
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00010  Glycolysis / Gluconeogenesis
sgi00071  Fatty acid degradation
sgi00350  Tyrosine metabolism
sgi00625  Chloroalkane and chloroalkene degradation
sgi00626  Naphthalene degradation
sgi00680  Methane metabolism
sgi01100  Metabolic pathways
sgi01110  Biosynthesis of secondary metabolites
sgi01120  Microbial metabolism in diverse environments
sgi01130  Biosynthesis of antibiotics
sgi01200  Carbon metabolism
sgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRAN_3519
  09102 Energy metabolism
   00680 Methane metabolism
    SGRAN_3519
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGRAN_3519
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SGRAN_3519
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGRAN_3519
   00626 Naphthalene degradation
    SGRAN_3519
Enzymes [BR:sgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGRAN_3519
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SGRAN_3519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TrkA_N F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMG75861
UniProt: A0A120LUR3
Position
3853041..3854129
Genome map
AA seq 362 aa AA seqDB search
MKAAIFVAPGEALRLEEVESLPLGPTDVHVRVDATALCQTDVAVRRGDHSYGSPLLMGHE
ASGTVLAVGSHVAGLKAGDTVISSSAPACGHCIQCASGRPHICVQSLHLRSVPRARRADG
SVATGLFGLGTFAEEMVIDRASLVAVDTDQPPESLALIGCGVTTGLSTVLNRTQLSHGGS
LAVIGCGTVGLAAILGAGLKGAATIVAIDPNPARRDDARRRGATLVIDPGAGDPAEAVRA
ATGGLGVDATIDAVAAPATVAQAQAITRRSGEIVIVGMPPADGTFELAALPFFLSEQRLS
SALFGSANIRRDFPAFVRLAESGRLDLAGFVSRTLALGDVNAGLDALSRGEILRAVIRPG
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcgatcttcgtcgcgcccggcgaggcactgcggctggaagaggtggagagc
ctgccgctcgggccgaccgacgtgcatgtccgcgtcgacgccaccgcgctctgccagacc
gatgtcgccgtgcgccgcggcgatcacagctatggatcgccgctgctgatggggcacgaa
gcgagcggcaccgtgctggccgtcggcagccatgtcgcggggctgaaggccggcgacacg
gtcatcagctcgtcggcgccggcatgcggccactgcatccagtgcgcctccggccgcccg
catatctgcgtccagtcgcttcacctgcgatcggtgccccgcgcgcgccgcgccgacgga
tcggtcgcgaccggccttttcgggctcggaaccttcgccgaggaaatggtgatcgaccgg
gcatcgctagtcgcggtcgataccgatcagccgcccgaatcgctggccctgatcgggtgc
ggcgtcaccaccggcctgtcgaccgttctcaaccggacccagctgtcgcatggcgggtcg
ctggcggtcatcggctgcggcaccgtgggactcgccgctatcctgggcgcgggcctgaag
ggtgcggcgacgatcgtcgccatcgaccccaaccccgcgcgccgcgacgatgcccggcgc
cggggcgcgacgctggtcatcgacccgggggcgggcgatccggccgaggccgtccgcgcc
gcgaccggcggactgggcgtcgacgcgaccatcgatgcggtcgcagccccggccaccgtg
gcgcaggcgcaggcgatcacgcgccgttcgggggaaatcgtcatcgtcggcatgccgccg
gcggacgggacgttcgagctggccgccctgcccttcttcctgtccgaacagcgcctgtcg
agcgcgctgttcggttcggcgaacatccgccgcgactttcccgctttcgtccggctggcc
gaaagcggccggctcgatctcgccggcttcgtcagccgcacgctggcgctgggcgacgtg
aacgcggggctcgacgccttgtcgcgcggagagatactgcgcgcggtgatccgccccggc
cgccggtga

DBGET integrated database retrieval system