KEGG   Sphingopyxis granuli: SGRAN_3645Help
Entry
SGRAN_3645        CDS       T04372                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00071  Fatty acid degradation
sgi00072  Synthesis and degradation of ketone bodies
sgi00280  Valine, leucine and isoleucine degradation
sgi00310  Lysine degradation
sgi00362  Benzoate degradation
sgi00380  Tryptophan metabolism
sgi00620  Pyruvate metabolism
sgi00630  Glyoxylate and dicarboxylate metabolism
sgi00640  Propanoate metabolism
sgi00650  Butanoate metabolism
sgi00900  Terpenoid backbone biosynthesis
sgi01100  Metabolic pathways
sgi01110  Biosynthesis of secondary metabolites
sgi01120  Microbial metabolism in diverse environments
sgi01130  Biosynthesis of antibiotics
sgi01200  Carbon metabolism
sgi01212  Fatty acid metabolism
sgi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGRAN_3645
   00630 Glyoxylate and dicarboxylate metabolism
    SGRAN_3645
   00640 Propanoate metabolism
    SGRAN_3645
   00650 Butanoate metabolism
    SGRAN_3645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGRAN_3645
   00072 Synthesis and degradation of ketone bodies
    SGRAN_3645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGRAN_3645
   00310 Lysine degradation
    SGRAN_3645
   00380 Tryptophan metabolism
    SGRAN_3645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SGRAN_3645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGRAN_3645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SGRAN_3645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgi04147]
    SGRAN_3645
Enzymes [BR:sgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SGRAN_3645
Exosome [BR:sgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SGRAN_3645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMG75984
UniProt: A0A0X8R6C6
Position
3989801..3991303
Genome map
AA seq 500 aa AA seqDB search
MSMTDPERIPVIIGVGQVGDRPDDPDRGLDSLGLMVEALKVAAQDAGVPLADIDSLAIVD
QISFHHLGKLCEPLAAAIGAAPAINYQSAAPHGDTPIRLLNEAANRIGAGEVKLAAVVGG
EALRTAAGRAAKAASGEDKSYNAVRKVATRREPNYAQRHGLSAPVDIYPLYENATRAAWG
ESLEDAQFESAEIWSRFSEVAAENPGAWIRKPASPADILDVNERNRPIAFPYSKLMVANS
SVNQGAGFLVASLAEARRRGIAEDRLIYVGMGAAAKEPASILARDRYDHSVSMETSIART
LDLNGMTVEDFDCVELYSCFPCVPKMARRILGWPWDRPASVFGGLTFGGGPIANYMSHAV
VSMVDKLRREGRYGFLFANGGFATDNHCIVLGNRPIAAARFPQDFDHQAEAEEKRGPVPE
LVEDYAGPATIESYTVFYGRDGAPRAGVVVARTPEGQRTLAHVDVRDAAMLAFLTDGTHE
PVGTEGRIVALDEGFGWRRT
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaccgatcccgaacgcattcccgtcatcatcggcgtcgggcaggtgggcgac
cgccccgacgatcccgaccgggggctcgactcgctcggcctgatggtcgaggcgttaaag
gtcgcggcgcaggacgccggcgttccgctcgccgacatcgacagtctcgcgatcgtcgac
cagatcagcttccatcatctcggcaagctatgcgaaccgctcgcggcggcgatcggggcg
gcgcccgcgatcaactaccagtcggcggcaccgcatggcgacacgccgatccgcctgctc
aacgaggccgcgaaccgcatcggcgcgggcgaggtcaagctggcggccgtcgtcggtggc
gaggcgctgcgcaccgccgcgggtcgcgccgccaaggcggcgagcggcgaggacaagagc
tataatgccgtgcgcaaggtggcgacgcggcgcgagcccaactacgcccagaggcacggc
ctgtcggcgccggtcgacatctatccgctctacgaaaatgcgacgcgcgcggcgtggggc
gaaagcctcgaggacgcgcagttcgaaagcgccgaaatctggtcgcgcttttcggaggtc
gcggcggaaaaccccggcgcatggataagaaagcccgcctcgcccgccgacatcctcgat
gtgaacgaacgcaaccgcccgatcgcctttccctattcgaagctgatggtcgccaattcg
tcggtgaaccagggcgcgggcttcctcgtcgccagccttgccgaggcacggcggcgcggc
atcgccgaggatcggctgatctatgtcggcatgggcgcggccgcgaaggaacccgcgagc
attctggcgcgcgaccgctacgaccatagcgtcagcatggagacgtcgatcgcccgcacg
ctcgacctgaacggcatgacggtcgaggatttcgactgcgtcgaactctacagctgcttt
ccctgcgtgcccaagatggcgcggcgcatcctcggctggccgtgggaccggcccgcaagc
gtgttcggcggcctgaccttcggcggcggcccgatcgccaattacatgagccacgcggtc
gtctcgatggtcgacaagctgcgccgcgaaggccgctatggcttcctgttcgccaatggc
ggtttcgcgaccgacaatcattgcatcgtgctgggcaaccggccgatcgccgcggcacgc
tttccgcaggatttcgaccatcaggccgaagccgaggaaaagcgcggtcccgtccccgaa
ctcgtcgaggattatgcggggccggcgacgatcgagagctatacggtcttctacgggcgc
gacggcgcgcccagggcaggcgtcgtcgtcgcgcgcacgcccgaagggcagcgcacgctc
gcgcatgtcgacgtgcgcgacgcggcgatgctggcgttcctgaccgacggcacgcacgag
ccggtgggcaccgaagggcggatcgtggcgctggacgagggattcggctggcgacgaacg
taa

DBGET integrated database retrieval system