KEGG   Sodalis glossinidius: SG0988
Entry
SG0988            CDS       T00316                                 

Name
(GenBank) formate acetyltransferase 1
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sgl  Sodalis glossinidius
Pathway
sgl00620  Pyruvate metabolism
sgl00640  Propanoate metabolism
sgl00650  Butanoate metabolism
sgl01100  Metabolic pathways
sgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SG0988
   00640 Propanoate metabolism
    SG0988
   00650 Butanoate metabolism
    SG0988
Enzymes [BR:sgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SG0988
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: BAE74263
UniProt: Q2NUB2
Position
complement(1624825..1627107)
AA seq 760 aa
MTDLNSKLSTAWEGFNAGDWQKEVNVRDFIRINYTPYEGDEAFLAGATAATASLWDKVME
GIKIENRTHAPVDFDTDIAATITSHDAGYINKSLEKVVGLQTDAPLKRAIIPFGGIKMVE
SSCKAYDRELDPGLKKIFTDYRKTHNQGVFDVYTPDILRCRKAGVLTGLPDAYGRGRIIG
DYRRVALYGIDYLMKDKFAQFQSLQTKLENGEELEQTIRLREEIADQHRALGQIKEMAAK
YGCDISGPATTAQEAVQWTYFGYLAAVKSQNGAAMSFGRVSTFLDVYIERDLKAGKLSEE
QAQELIDHLVMKLRMVRFLRTPEYDELFSGDPIWATESLGGMGIDGRTLVTKNSFRFLNT
LYTMGPSPEPNMTILWSEKLPINFKKFTAKVSIDTSSVQYENDDLMRPDFNNDDYAIACC
VSPMVVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKWEPLAEDVLDYDRVLERT
DHFMDWLAKQYVTALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSIAADSLSAI
KYAKVKPIRDEDGLAINFDIEGEYPQFGNNDPRVDDIARDLVERFMKKIQKLTTYRGAVP
TQSILTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYA
KDGISYTFSIIPKALGKDDDVRKANLAGLMDGYFHHEAGVEGGQHLNVNVMNREMLVKAM
EHPEDYPNLTIRVSGYAVRFNSLTKEQQKDVITRTFTESM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgatctgaatagcaaactgtccacggcctgggaaggttttaacgcaggagactgg
cagaaagaagtcaacgtgcgtgacttcatccgaataaactacactccctatgaaggcgac
gaagctttcctggccggcgccaccgccgccaccgcgtcgctgtgggacaaagttatggaa
ggaatcaaaatcgagaaccgcacccatgcgccggtcgattttgataccgatattgctgcc
accattacctcccacgacgccggctatatcaataaatcgctggaaaaagtcgtcggcctg
cagacggatgcaccgttaaaacgcgccatcatcccttttggtggcatcaaaatggtagaa
agctcctgcaaagcgtacgatcgcgagctggatccgggtctgaaaaaaatcttcaccgac
taccgtaagacccataaccagggcgtgttcgatgtctatacccccgacattctgcgctgt
cgtaaagcgggcgtactgaccggtctgccggacgcctacggccgcggacgcatcatcggc
gactaccgccgtgttgctctgtacggcatcgattacctgatgaaagataaattcgcccag
ttccagtctctgcaaaccaaattggaaaacggcgaagagctggaacagaccatccgtctg
cgcgaagaaatcgccgatcagcaccgtgctctaggccaaattaaagaaatggccgccaaa
tacggctgcgatatttccgggccggccacgaccgcgcaggaagccgtgcagtggacctac
ttcggctatctggccgccgtcaaatcacaaaacggcgccgcgatgtccttcggccgcgta
tctaccttccttgacgtgtacatcgaacgcgacctgaaagccggtaagctttcggaagaa
caggcgcaagagcttatcgaccatctggtcatgaagttgcgtatggtgcgcttcctgcgt
acaccggaatatgatgaactgttctccggcgacccgatttgggcaaccgaatccctcggc
ggcatgggcatcgacggccgtacgctggtgaccaaaaacagtttccgtttcctgaacacc
ctgtataccatggggccatcgccggaaccgaatatgaccatcctgtggtcggaaaaactg
ccgatcaatttcaagaaatttaccgcaaaagtatccatcgacacctcatctgtgcagtat
gaaaacgatgacctgatgcgtccggacttcaataacgacgattatgccattgcctgctgc
gtcagcccgatggtcgtcggcaagcaaatgcagttcttcggcgcccgagccaacctggca
aaaaccatgctgtacgccatcaatggtggcgtggacgaaaaactgaaaatgcaggtcggt
ccgaaatgggaaccgctggcggaggacgtgctggattatgatcgcgtgctggaacgtacc
gaccatttcatggactggctggcaaaacagtatgtcaccgcgctgaacatcatccattac
atgcatgataaatacagctacgaagcctcgctgatggcgctacacgaccgcgacgtttat
cgcaccatggcctgcggcatcgccggtttgtccatcgccgccgactcgctgtccgccatc
aaatatgccaaagtcaaacctatccgtgacgaagacggcctggctatcaactttgacatt
gaaggcgaatacccgcagtttggtaacaacgatccccgcgtcgacgatatcgcccgcgac
ctggttgaacgcttcatgaagaaaattcagaagctgaccacctatcgcggcgccgtaccg
acccagtcgattctcaccatcacctctaacgtggtgtatggtaagaaaactggtaatacg
ccggatggtcgtcgcgccggtgcgccattcggaccgggtgccaacccgatgcatggccgt
gaccagaaaggcgccgttgcctcgctgacctcggtggcgaaactgccgttcgcctatgcg
aaggacgggatttcctataccttctctatcattccgaaggcgctgggtaaagatgacgac
gtacgtaaagccaatttggcgggtctgatggacggttatttccatcatgaagccggcgtt
gaaggcggtcagcacctgaacgttaacgtcatgaaccgtgaaatgctggtgaaggcgatg
gagcatccggaagattacccgaaccttaccattcgtgtgtccgggtatgcggtccgcttc
aactcgctgaccaaagagcagcagaaagacgtgattacccgtaccttcactgaatcaatg
tag

DBGET integrated database retrieval system