KEGG   Sodalis glossinidius: SG1983
Entry
SG1983            CDS       T00316                                 
Name
(GenBank) galactose operon repressor
  KO
K02529  LacI family transcriptional regulator
Organism
sgl  Sodalis glossinidius
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgl03000]
    SG1983
Transcription factors [BR:sgl03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    SG1983
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_Tnp_ISL3 HTH_3 HTH_23 PucR HTH_31 HTH_17 DUF3853 HTH_38 MerR HTH_26 Trp_repressor
Other DBs
NCBI-ProteinID: BAE75258
UniProt: Q2NRG7
Position
3427102..3428127
AA seq 341 aa
MATIKDVARLAGVSVATVSRVINNSPKTSDGSRQAVMQAMEQLQYHPNANARALAQQSTE
TLGLIVADVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHILDKERQAIEQLIRHRCAALV
VHAQMIPTEELNTLMAHIPGMVLINRILPDYADRCVALDDRYGAWLATRHLIQMGHRRIA
FICSSHSIPDSVDRLQGYRDALEEFHIALDEKLIAFGEPDEVGGEQAMTELLGRGRTFTA
ITCYNDSTAAGAMAVLSDNGIEVPQDISLVGFDDVLISRYLRPRLTTICYPVVAMATQAA
QLALALANGAPLPEVTNMFSPTLVRRHSVAPAAWRRTHLQA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctaccataaaggatgtcgccagactggccggcgtttcagtcgccaccgtctcgcgt
gtgattaacaattcgcccaaaaccagcgatggatcgcgccaggcggtcatgcaggcgatg
gaacaattgcaataccaccccaacgccaacgcccgcgcgctggcgcaacagtccacggaa
accctgggattgattgtcgcggatgtctcggatcctttcttcggcgccatggtgaaggcg
gtggaacaagtggcgtaccataccggcaacttcctgctgatcggcaacggttaccatatt
ctggataaagagcgccaggcgattgagcagctaatccgtcaccgctgcgccgcgctggtg
gtgcacgcacagatgatcccgaccgaagagctgaatacgttaatggcgcatatcccgggc
atggtgcttatcaaccgtattctgccggattacgccgatcgctgcgtggcgctggacgat
cgctacggcgcctggctggccacgcgccatctcatccagatgggacatcggcgcatcgcc
tttatctgctcaagccacagtattcccgacagcgtcgaccgccttcagggctatcgggac
gcgctggaggagtttcatattgccctggatgagaaactgattgcgttcggtgaaccggat
gaggtcggcggcgaacaggcgatgaccgagcttcttgggcgcggccgcacgtttaccgcc
atcacctgctataacgactcgacagccgccggcgctatggcggtattgagcgataacggc
attgaggtaccgcaggatatttcgctagtgggattcgatgatgtgctgatctcccgctac
ctgcggcctcggctgaccaccatttgttatccggtggtggccatggccacccaggcggca
cagctggcgctggcgctggctaacggcgcgccgctgccggaggtgaccaatatgtttagc
ccgacgctggtacgtcgccattccgtcgcgccggcggcgtggcgtcggacgcaccttcag
gcttga

DBGET integrated database retrieval system